PDB entry 2wp3
View 2wp3 on RCSB PDB site
Description: crystal structure of the titin m10-obscurin like 1 ig complex
Class: transferase/structural protein
Keywords: transferase-structural protein complex, sarcomere, immunoglobulin domain, limb-girdle muscular dystrophy, serine/threonine-protein kinase, ATP-binding, kelch repeat, cardiomyopathy, calmodulin-binding
Deposited on
2009-08-02, released
2010-02-16
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-08-24, with a file datestamp of
2011-08-19.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.17754
AEROSPACI score: 0.62
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'O':
Compound: Obscurin-like protein 1
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'T':
Compound: titin
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- PDB 2WP3
- Uniprot Q8WZ42 (3-101)
Domains in SCOPe 2.06: d2wp3t_ - Heterogens: GOL, SO4, HOH
PDB Chain Sequences:
- Chain 'O':
No sequence available.
- Chain 'T':
Sequence, based on SEQRES records: (download)
>2wp3T (T:)
gssrgippkiealpsdisidegkvltvacaftgeptpevtwscggrkihsqeqgrfhien
tddlttliimdvqkqdgglytlslgnefgsdsatvnihirsi
Sequence, based on observed residues (ATOM records): (download)
>2wp3T (T:)
rgippkiealpsdisidegkvltvacaftgeptpevtwscggrkihsqeqgrfhientdd
lttliimdvqkqdgglytlslgnefgsdsatvnihirsi