PDB entry 2wp3

View 2wp3 on RCSB PDB site
Description: crystal structure of the titin m10-obscurin like 1 ig complex
Class: transferase/structural protein
Keywords: transferase-structural protein complex, sarcomere, immunoglobulin domain, limb-girdle muscular dystrophy, serine/threonine-protein kinase, ATP-binding, kelch repeat, cardiomyopathy, calmodulin-binding
Deposited on 2009-08-02, released 2010-02-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.17754
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: Obscurin-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: titin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WP3
    • Uniprot Q8WZ42 (3-101)
    Domains in SCOPe 2.06: d2wp3t_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'O':
    No sequence available.

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2wp3T (T:)
    gssrgippkiealpsdisidegkvltvacaftgeptpevtwscggrkihsqeqgrfhien
    tddlttliimdvqkqdgglytlslgnefgsdsatvnihirsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wp3T (T:)
    rgippkiealpsdisidegkvltvacaftgeptpevtwscggrkihsqeqgrfhientdd
    lttliimdvqkqdgglytlslgnefgsdsatvnihirsi