PDB entry 2wos

View 2wos on RCSB PDB site
Description: structure of human s100a7 in complex with 2,6 ans
Class: calcium-binding protein
Keywords: calcium-binding protein, disulfide bond, metal-binding, s100a7, secreted, psoriasin
Deposited on 2009-07-27, released 2009-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.1821
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein s100-a7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31151 (0-End)
      • conflict (26)
    Domains in SCOPe 2.08: d2wosa_
  • Heterogens: CA, 6AN, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2wosA (A:)
sntqaersiigmidmfhkytrrddkidkpslltmmkenfpnflsacdkkgtnyladvfek
kdknedkkidfseflsllgdiatdyhkqshgaapcsggsq

    Sequence, based on observed residues (ATOM records): (download) 
    >2wosA (A:)
sntqaersiigmidmfhkytrrddkidkpslltmmkenfpnflsacdkkgtnyladvfek
kdknedkkidfseflsllgdiatdyhkqshgaapcs