PDB entry 2wor

View 2wor on RCSB PDB site
Description: co-structure of s100a7 with 1,8 ans
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 2009-07-27, released 2009-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.188
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein s100-a7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31151 (0-End)
      • conflict (26)
    Domains in SCOPe 2.08: d2wora_
  • Heterogens: CA, 2AN, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2worA (A:)
sntqaersiigmidmfhkytrrddkidkpslltmmkenfpnflsacdkkgtnyladvfek
kdknedkkidfseflsllgdiatdyhkqshgaapcsggsq

    Sequence, based on observed residues (ATOM records): (download) 
    >2worA (A:)
sntqaersiigmidmfhkytrrddkidkpslltmmkenfpnflsacdkkgtnyladvfek
kdknedkkidfseflsllgdiatdyhkqshgaapcs