PDB entry 2woq

View 2woq on RCSB PDB site
Description: porphobilinogen synthase (hemb) in complex with 5-acetamido-4-oxohexanoic acid (alaremycin 2)
Class: lyase/antibiotic
Keywords: lyase-antibiotic complex, lyase antibiotic complex, metal-binding, heme biosynthesis, porphyrin biosynthesis, porpobilinogen synthase, hemb, lyase, inhibitor,
Deposited on 2009-07-27, released 2009-10-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.14736
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta-aminolevulinic acid dehydratase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2woqa_
  • Heterogens: AYC, MG, EPE, PE5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2woqA (A:)
    msftpanraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgv
    erlsidqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfp
    elgiitdvaldpftthgqdgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdg
    rigairealesaghtnvrimaysakyasayygpfrdavgsasnlgkgnkatyqmdpansd
    ealhevaadlaegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngw
    laesvilesltafkragadgiltyfakqaaeqlrrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2woqA (A:)
    panraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverls
    idqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgi
    itdvaldpftthgqdgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgriga
    irealesaghtnvrimaysakyasayygpfrdavgsasnlgkgnkatyqmdpansdealh
    evaadlaegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaes
    vilesltafkragadgiltyfakqaaeql