PDB entry 2woh

View 2woh on RCSB PDB site
Description: strontium soaked e. coli copper amine oxidase
Class: oxidoreductase
Keywords: tpq, metal-binding, oxidoreductase, amine oxidation
Deposited on 2009-07-23, released 2010-05-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-05-05, with a file datestamp of 2010-04-30.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.18847
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wohA (A:)
    hggeahmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvp
    vvmkdnkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpn
    trfteisllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpi
    kdahgmvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqda
    rllkvisyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva
    pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
    slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
    meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
    gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
    nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
    vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
    dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
    galkkdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wohA (A:)
    mvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkdn
    kawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpntrftei
    sllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpikdahgm
    vllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkvi
    syldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrvapavkpm
    qiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyegslggmi
    vpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvpmeipra
    iavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengtigidaga
    tgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgennslvam
    dpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnpvsyqii
    pyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsthdtglgq
    yskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptlgalkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wohB (B:)
    hggeahmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvp
    vvmkdnkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpn
    trfteisllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpi
    kdahgmvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqda
    rllkvisyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva
    pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
    slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
    meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
    gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
    nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
    vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
    dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
    galkkdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wohB (B:)
    hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd
    nkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpntrfte
    isllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpikdahg
    mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
    isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrvapavkp
    mqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyegslggm
    ivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvpmeipr
    aiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengtigidag
    atgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgennslva
    mdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnpvsyqi
    ipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsthdtglg
    qyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptlgalkk
    d