PDB entry 2woe

View 2woe on RCSB PDB site
Description: crystal structure of the d97n variant of dinitrogenase reductase-activating glycohydrolase (drag) from rhodospirillum rubrum in complex with ADP-ribose
Class: hydrolase
Keywords: hydrolase, dimanganese, nitrogen fixation, ADP-ribosylglycohydrolase, mono-ADP-ribosylhydrolase
Deposited on 2009-07-23, released 2009-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.16912
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosyl-[dinitrogen reductase] glycohydrolase
    Species: RHODOSPIRILLUM RUBRUM [TaxId:1085]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WOE
      • engineered mutation (101)
    • Uniprot P14300
    Domains in SCOPe 2.07: d2woea_
  • Chain 'B':
    Compound: ADP-ribosyl-[dinitrogen reductase] glycohydrolase
    Species: RHODOSPIRILLUM RUBRUM [TaxId:1085]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WOE
      • engineered mutation (101)
    • Uniprot P14300
    Domains in SCOPe 2.07: d2woeb_
  • Chain 'C':
    Compound: ADP-ribosyl-[dinitrogen reductase] glycohydrolase
    Species: RHODOSPIRILLUM RUBRUM [TaxId:1085]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WOE
      • engineered mutation (101)
    • Uniprot P14300
    Domains in SCOPe 2.07: d2woec_
  • Heterogens: MN, AR6, TLA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2woeA (A:)
    gplgsmtgpsvhdralgaflglavgdalgatvefmtkgeiaqqygihrkmtgggwlrlkp
    gqitddtemslalgrslaakgtldvadiceefalwlksrpvnvgntcrrgirrymhegtt
    tapysegdagngaamrclpaalatlghpadlepwvlaqarithnhplsdaacltlgrmvh
    hliggrgmkacreeanrlvhqhrdfhfepykgqssayivdtmqtvlhyyfvtdtfkscli
    qtvnqggdadttgalagmlagatygvddipsgwlskldmkvereirrqvdallalagld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2woeA (A:)
    gpsvhdralgaflglavgdalgatvefmtkgeiaqqygihrkmtgggwlrlkpgqitddt
    emslalgrslaakgtldvadiceefalwlksrpvnvgntcrrgirrymhegtttapyseg
    dagngaamrclpaalatlghpadlepwvlaqarithnhplsdaacltlgrmvhhliggrg
    mkacreeanrlvhqhrdfhfepykgqssayivdtmqtvlhyyfvtdtfkscliqtvnqgg
    dadttgalagmlagatygvddipsgwlskldmkvereirrqvdallalagl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2woeB (B:)
    gplgsmtgpsvhdralgaflglavgdalgatvefmtkgeiaqqygihrkmtgggwlrlkp
    gqitddtemslalgrslaakgtldvadiceefalwlksrpvnvgntcrrgirrymhegtt
    tapysegdagngaamrclpaalatlghpadlepwvlaqarithnhplsdaacltlgrmvh
    hliggrgmkacreeanrlvhqhrdfhfepykgqssayivdtmqtvlhyyfvtdtfkscli
    qtvnqggdadttgalagmlagatygvddipsgwlskldmkvereirrqvdallalagld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2woeB (B:)
    gpsvhdralgaflglavgdalgatvefmtkgeiaqqygihrkmtgggwlrlkpgqitddt
    emslalgrslaakgtldvadiceefalwlksrpvnvgntcrrgirrymhegtttapyseg
    dagngaamrclpaalatlghpadlepwvlaqarithnhplsdaacltlgrmvhhliggrg
    mkacreeanrlvhqhrdfhfepykgqssayivdtmqtvlhyyfvtdtfkscliqtvnqgg
    dadttgalagmlagatygvddipsgwlskldmkvereirrqvdallalagl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2woeC (C:)
    gplgsmtgpsvhdralgaflglavgdalgatvefmtkgeiaqqygihrkmtgggwlrlkp
    gqitddtemslalgrslaakgtldvadiceefalwlksrpvnvgntcrrgirrymhegtt
    tapysegdagngaamrclpaalatlghpadlepwvlaqarithnhplsdaacltlgrmvh
    hliggrgmkacreeanrlvhqhrdfhfepykgqssayivdtmqtvlhyyfvtdtfkscli
    qtvnqggdadttgalagmlagatygvddipsgwlskldmkvereirrqvdallalagld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2woeC (C:)
    gpsvhdralgaflglavgdalgatvefmtkgeiaqqygihrkmtgggwlrlkpgqitddt
    emslalgrslaakgtldvadiceefalwlksrpvnvgntcrrgirrymhegtttapyseg
    dagngaamrclpaalatlghpadlepwvlaqarithnhplsdaacltlgrmvhhliggrg
    mkacreeanrlvhqhrdfhfepykgqssayivdtmqtvlhyyfvtdtfkscliqtvnqgg
    dadttgalagmlagatygvddipsgwlskldmkvereirrqvdallalagl