PDB entry 2wod

View 2wod on RCSB PDB site
Description: crystal structure of the dinitrogenase reductase-activating glycohydrolase (drag) from rhodospirillum rubrum in complex with ADP-ribsoyllysine
Class: hydrolase
Keywords: hydrolase, nitrogen fixation, dimanganese-dependent, ADP-ribosylglycohydrolase, mono-ADP-ribosylhydrolase
Deposited on 2009-07-23, released 2009-08-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.199
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosyl-[dinitrogen reductase] glycohydrolase
    Species: RHODOSPIRILLUM RUBRUM [TaxId:1085]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2woda_
  • Chain 'B':
    Compound: ADP-ribosyl-[dinitrogen reductase] glycohydrolase
    Species: RHODOSPIRILLUM RUBRUM [TaxId:1085]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2wodb_
  • Heterogens: MN, ZZC, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wodA (A:)
    gplgsmtgpsvhdralgaflglavgdalgatvefmtkgeiaqqygihrkmtgggwlrlkp
    gqitddtemslalgrslaakgtldvadiceefalwlksrpvdvgntcrrgirrymhegtt
    tapysegdagngaamrclpaalatlghpadlepwvlaqarithnhplsdaacltlgrmvh
    hliggrgmkacreeanrlvhqhrdfhfepykgqssayivdtmqtvlhyyfvtdtfkscli
    qtvnqggdadttgalagmlagatygvddipsgwlskldmkvereirrqvdallalagld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wodA (A:)
    gpsvhdralgaflglavgdalgatvefmtkgeiaqqygihrkmtgggwlrlkpgqitddt
    emslalgrslaakgtldvadiceefalwlksrpvdvgntcrrgirrymhegtttapyseg
    dagngaamrclpaalatlghpadlepwvlaqarithnhplsdaacltlgrmvhhliggrg
    mkacreeanrlvhqhrdfhfepykgqssayivdtmqtvlhyyfvtdtfkscliqtvnqgg
    dadttgalagmlagatygvddipsgwlskldmkvereirrqvdallalagl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wodB (B:)
    gplgsmtgpsvhdralgaflglavgdalgatvefmtkgeiaqqygihrkmtgggwlrlkp
    gqitddtemslalgrslaakgtldvadiceefalwlksrpvdvgntcrrgirrymhegtt
    tapysegdagngaamrclpaalatlghpadlepwvlaqarithnhplsdaacltlgrmvh
    hliggrgmkacreeanrlvhqhrdfhfepykgqssayivdtmqtvlhyyfvtdtfkscli
    qtvnqggdadttgalagmlagatygvddipsgwlskldmkvereirrqvdallalagld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wodB (B:)
    gpsvhdralgaflglavgdalgatvefmtkgeiaqqygihrkmtgggwlrlkpgqitddt
    emslalgrslaakgtldvadiceefalwlksrpvdvgntcrrgirrymhegtttapyseg
    dagngaamrclpaalatlghpadlepwvlaqarithnhplsdaacltlgrmvhhliggrg
    mkacreeanrlvhqhrdfhfepykgqssayivdtmqtvlhyyfvtdtfkscliqtvnqgg
    dadttgalagmlagatygvddipsgwlskldmkvereirrqvdallalagl