PDB entry 2woc

View 2woc on RCSB PDB site
Description: crystal structure of the dinitrogenase reductase-activating glycohydrolase (drag) from rhodospirillum rubrum
Class: hydrolase
Keywords: hydrolase, dimanganese, nitrogen fixation, ADP-ribosylglycohydrolase, mono-ADP-ribosylhydrolase
Deposited on 2009-07-23, released 2009-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.17757
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosyl-[dinitrogen reductase] glycohydrolase
    Species: RHODOSPIRILLUM RUBRUM [TaxId:1085]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2woca_
  • Chain 'B':
    Compound: ADP-ribosyl-[dinitrogen reductase] glycohydrolase
    Species: RHODOSPIRILLUM RUBRUM [TaxId:1085]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wocb_
  • Chain 'C':
    Compound: ADP-ribosyl-[dinitrogen reductase] glycohydrolase
    Species: RHODOSPIRILLUM RUBRUM [TaxId:1085]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wocc_
  • Heterogens: MN, FMT, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wocA (A:)
    gplgsmtgpsvhdralgaflglavgdalgatvefmtkgeiaqqygihrkmtgggwlrlkp
    gqitddtemslalgrslaakgtldvadiceefalwlksrpvdvgntcrrgirrymhegtt
    tapysegdagngaamrclpaalatlghpadlepwvlaqarithnhplsdaacltlgrmvh
    hliggrgmkacreeanrlvhqhrdfhfepykgqssayivdtmqtvlhyyfvtdtfkscli
    qtvnqggdadttgalagmlagatygvddipsgwlskldmkvereirrqvdallalagld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wocA (A:)
    gpsvhdralgaflglavgdalgatvefmtkgeiaqqygihrkmtgggwlrlkpgqitddt
    emslalgrslaakgtldvadiceefalwlksrpvdvgntcrrgirrymhegtttapyseg
    dagngaamrclpaalatlghpadlepwvlaqarithnhplsdaacltlgrmvhhliggrg
    mkacreeanrlvhqhrdfhfepykgqssayivdtmqtvlhyyfvtdtfkscliqtvnqgg
    dadttgalagmlagatygvddipsgwlskldmkvereirrqvdallalagl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wocB (B:)
    gplgsmtgpsvhdralgaflglavgdalgatvefmtkgeiaqqygihrkmtgggwlrlkp
    gqitddtemslalgrslaakgtldvadiceefalwlksrpvdvgntcrrgirrymhegtt
    tapysegdagngaamrclpaalatlghpadlepwvlaqarithnhplsdaacltlgrmvh
    hliggrgmkacreeanrlvhqhrdfhfepykgqssayivdtmqtvlhyyfvtdtfkscli
    qtvnqggdadttgalagmlagatygvddipsgwlskldmkvereirrqvdallalagld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wocB (B:)
    gpsvhdralgaflglavgdalgatvefmtkgeiaqqygihrkmtgggwlrlkpgqitddt
    emslalgrslaakgtldvadiceefalwlksrpvdvgntcrrgirrymhegtttapyseg
    dagngaamrclpaalatlghpadlepwvlaqarithnhplsdaacltlgrmvhhliggrg
    mkacreeanrlvhqhrdfhfepykgqssayivdtmqtvlhyyfvtdtfkscliqtvnqgg
    dadttgalagmlagatygvddipsgwlskldmkvereirrqvdallalagl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wocC (C:)
    gplgsmtgpsvhdralgaflglavgdalgatvefmtkgeiaqqygihrkmtgggwlrlkp
    gqitddtemslalgrslaakgtldvadiceefalwlksrpvdvgntcrrgirrymhegtt
    tapysegdagngaamrclpaalatlghpadlepwvlaqarithnhplsdaacltlgrmvh
    hliggrgmkacreeanrlvhqhrdfhfepykgqssayivdtmqtvlhyyfvtdtfkscli
    qtvnqggdadttgalagmlagatygvddipsgwlskldmkvereirrqvdallalagld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wocC (C:)
    gpsvhdralgaflglavgdalgatvefmtkgeiaqqygihrkmtgggwlrlkpgqitddt
    emslalgrslaakgtldvadiceefalwlksrpvdvgntcrrgirrymhegtttapyseg
    dagngaamrclpaalatlghpadlepwvlaqarithnhplsdaacltlgrmvhhliggrg
    mkacreeanrlvhqhrdfhfepykgqssayivdtmqtvlhyyfvtdtfkscliqtvnqgg
    dadttgalagmlagatygvddipsgwlskldmkvereirrqvdallalagl