PDB entry 2woa

View 2woa on RCSB PDB site
Description: mmp12 complex with a beta hydroxy carboxylic acid
Class: hydrolase
Keywords: hydrolase, polymorphism, glycoprotein, metal-binding, matrix metalloprotease mmp-12 complex structure, disulfide bond, metalloprotease, extracellular matrix, zinc, calcium, zymogen, protease, secreted
Deposited on 2009-07-22, released 2009-09-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-09-22, with a file datestamp of 2009-09-18.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.157
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WOA (0-0)
    • Uniprot P39900 (1-End)
    Domains in SCOPe 2.04: d2woaa_
  • Chain 'B':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WOA (0-0)
    • Uniprot P39900 (1-End)
    Domains in SCOPe 2.04: d2woab_
  • Chain 'C':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WOA (0-0)
    • Uniprot P39900 (1-End)
    Domains in SCOPe 2.04: d2woac_
  • Chain 'D':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WOA
    • Uniprot P39900 (1-End)
    Domains in SCOPe 2.04: d2woad_
  • Heterogens: SO4, ZN, CA, 576, 023, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2woaA (A:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptykyvdintfrlsaddirgiqslygdpken
    

    Sequence, based on observed residues (ATOM records): (download)
    >2woaA (A:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptykyvdintfrlsaddirgiqslygdpke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2woaB (B:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptykyvdintfrlsaddirgiqslygdpken
    

    Sequence, based on observed residues (ATOM records): (download)
    >2woaB (B:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptykyvdintfrlsaddirgiqslygdpke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2woaC (C:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptykyvdintfrlsaddirgiqslygdpken
    

    Sequence, based on observed residues (ATOM records): (download)
    >2woaC (C:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptykyvdintfrlsaddirgiqslygdpke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2woaD (D:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptykyvdintfrlsaddirgiqslygdpken
    

    Sequence, based on observed residues (ATOM records): (download)
    >2woaD (D:)
    gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
    gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
    lghssdpkavmfptykyvdintfrlsaddirgiqslygdp