PDB entry 2wo8

View 2wo8 on RCSB PDB site
Description: mmp12 complex with a beta hydroxy carboxylic acid
Class: hydrolase
Keywords: hydrolase, polymorphism, glycoprotein, metal-binding, matrix metalloprotease mmp-12 complex structure, metalloprotease, extracellular matrix, zymogen, protease, secreted
Deposited on 2009-07-22, released 2009-09-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-22, with a file datestamp of 2009-09-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18728
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WO8 (0-0)
    • Uniprot P39900 (1-163)
    Domains in SCOPe 2.06: d2wo8a_
  • Chain 'B':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WO8 (0-0)
    • Uniprot P39900 (1-End)
    Domains in SCOPe 2.06: d2wo8b_
  • Chain 'C':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WO8 (0-0)
    • Uniprot P39900 (1-End)
    Domains in SCOPe 2.06: d2wo8c_
  • Chain 'D':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WO8
    • Uniprot P39900 (1-End)
    Domains in SCOPe 2.06: d2wo8d_
  • Heterogens: ZN, CA, 077, SO4, 023, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wo8A (A:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptykyvdintfrlsaddirgiqslygdpken
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wo8B (B:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptykyvdintfrlsaddirgiqslygdpken
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wo8B (B:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptykyvdintfrlsaddirgiqslygdpke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wo8C (C:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptykyvdintfrlsaddirgiqslygdpken
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wo8C (C:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptykyvdintfrlsaddirgiqslygdpke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wo8D (D:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptykyvdintfrlsaddirgiqslygdpken
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wo8D (D:)
    gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
    gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
    lghssdpkavmfptykyvdintfrlsaddirgiqslygdp