PDB entry 2wo2

View 2wo2 on RCSB PDB site
Description: crystal structure of the epha4-ephrinb2 complex
Class: transferase/signaling protein
Keywords: transferase-signaling protein complex, osteogenesis, axon guidance, cell surface receptor, developmental protein, neurogenesis, cell signaling
Deposited on 2009-07-21, released 2009-10-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-11-09, with a file datestamp of 2011-11-04.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.21784
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ephrin type-a receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54764 (3-175)
      • expression tag (1-2)
      • expression tag (176-178)
    Domains in SCOPe 2.04: d2wo2a_
  • Chain 'B':
    Compound: ephrin-b2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2wo2b_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wo2A (A:)
    etgevtlldsrsvqgelgwiaspleggweevsimdekntpirtyqvcnvmepsqnnwlrt
    dwitregaqrvyieikftlrdcnslpgvmgtcketfnlyyyesdndkerfirenqfvkid
    tiaadesftqvdigdrimklnteirdvgplskkgfylafqdvgacialvsvrvfykrtkh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wo2A (A:)
    tgevtlldsrsvqgelgwiaspleggweevsimdekntpirtyqvcnvmepsqnnwlrtd
    witregaqrvyieikftlrdcnslpgvmgtcketfnlyyyesdndkerfirenqfvkidt
    iaadesftqvdigdrimklnteirdvgplskkgfylafqdvgacialvsvrvfykrtk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wo2B (B:)
    etgsivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdk
    dqadrctikkentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngsle
    gldnqeggvcqtramkilmkvgqdgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wo2B (B:)
    ivlepiywnssnskflpgqglvlypqigdkldiicpkvdgqyeyykvymvdkdqadrcti
    kkentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegldnqegg
    vcqtramkilmkvgqd