PDB entry 2wnx

View 2wnx on RCSB PDB site
Description: 3b' carbohydrate-binding module from the Cel9V glycoside hydrolase from Clostridium thermocellum
Class: hydrolase
Keywords: cellulose degradation, hydrolase, glycoside hydrolase
Deposited on 2009-07-20, released 2009-12-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 1.31 Å
R-factor: 0.12127
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycoside hydrolase, family 9
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3DJ30 (Start-158)
      • expression tag (159-161)
    Domains in SCOPe 2.08: d2wnxa1, d2wnxa2
  • Heterogens: CA, SO4, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2wnxA (A:)
mdpsqtpdanasisvsykcgvkdgtkntiratinikntgttpvnlsdikvrywftsdgne
qnnfvcdyaafgtdkvkgivkkiensvpgadtyceisftedagrlapggstgtipfrieg
aaeydqtddysynsemsddfgdntkitayikdklkygveaaalehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2wnxA (A:)
tpdanasisvsykcgvkdgtkntiratinikntgttpvnlsdikvrywftsdgneqnnfv
cdyaafgtdkvkgivkkiensvpgadtyceisftedagrlapggstgtipfriegaaeyd
qtddysynsemsddfgdntkitayikdklkygveaaa