PDB entry 2wnv

View 2wnv on RCSB PDB site
Description: complex between c1q globular heads and deoxyribose
Class: immune system
Keywords: immune system, c1q, secreted, collagen, complement, recognition, disulfide bond, innate immunity, immune response, pyrrolidone carboxylic acid, disease mutation, complement pathway, glycoprotein, hydroxylation
Deposited on 2009-07-20, released 2010-05-26
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-07-14, with a file datestamp of 2010-07-09.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.17629
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement c1q subcomponent subunit a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2wnva_
  • Chain 'B':
    Compound: complement c1q subcomponent subunit b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2wnvb_
  • Chain 'C':
    Compound: complement c1q subcomponent subunit c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2wnvc_
  • Chain 'D':
    Compound: complement c1q subcomponent subunit a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2wnvd_
  • Chain 'E':
    Compound: complement c1q subcomponent subunit b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2wnve_
  • Chain 'F':
    Compound: complement c1q subcomponent subunit c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2wnvf_
  • Heterogens: NAG, CA, 2DR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wnvA (A:)
    qprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqwei
    clsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgse
    adsvfsgflifpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wnvA (A:)
    qprpafsairrnppgnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqweicl
    sivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgsead
    svfsgflifpsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wnvB (B:)
    atqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassr
    gnlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmeg
    ansifsgfllfpdmea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wnvB (B:)
    tqkiafsatrtivplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrgn
    lcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmegan
    sifsgfllfpdm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wnvC (C:)
    kqkfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhash
    tanlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsd
    svfsgfllfpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wnvC (C:)
    kfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhashta
    nlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsdsv
    fsgfllfpd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wnvD (D:)
    qprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqwei
    clsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgse
    adsvfsgflifpsa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2wnvE (E:)
    atqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassr
    gnlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmeg
    ansifsgfllfpdmea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wnvE (E:)
    qkiafsatrtiplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrgnlc
    vnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmegansi
    fsgfllfpdm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2wnvF (F:)
    kqkfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhash
    tanlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsd
    svfsgfllfpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wnvF (F:)
    kfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhashta
    nlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsdsv
    fsgfllfpd