PDB entry 2wnu

View 2wnu on RCSB PDB site
Description: complex between c1q globular heads and heparan sulfate
Class: immune system
Keywords: collagen, innate immunity, immune response, pyrrolidone carboxylic acid, immune system, disease mutation, complement pathway, glycoprotein, hydroxylation
Deposited on 2009-07-20, released 2010-05-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-07-14, with a file datestamp of 2010-07-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.20064
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement c1q subcomponent subunit a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2wnua_
  • Chain 'B':
    Compound: complement c1q subcomponent subunit b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2wnub_
  • Chain 'C':
    Compound: complement c1q subcomponent subunit c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2wnuc_
  • Chain 'D':
    Compound: complement c1q subcomponent subunit a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2wnud_
  • Chain 'E':
    Compound: complement c1q subcomponent subunit b
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2wnue_
  • Chain 'F':
    Compound: complement c1q subcomponent subunit c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2wnuf_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wnuA (A:)
    qprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqwei
    clsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgse
    adsvfsgflifpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wnuA (A:)
    qprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqwei
    clsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgse
    adsvfsgflifps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wnuB (B:)
    atqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassr
    gnlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmeg
    ansifsgfllfpdmea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wnuB (B:)
    tqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrg
    nlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmega
    nsifsgfllfpdm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wnuC (C:)
    kqkfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhash
    tanlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsd
    svfsgfllfpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wnuC (C:)
    kfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhashta
    nlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsdsv
    fsgfllfpd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wnuD (D:)
    qprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqwei
    clsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgse
    adsvfsgflifpsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wnuD (D:)
    qprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqwei
    clsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgse
    adsvfsgflifps
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2wnuE (E:)
    atqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassr
    gnlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmeg
    ansifsgfllfpdmea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wnuE (E:)
    tqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrg
    nlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmega
    nsifsgfllfpdm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2wnuF (F:)
    kqkfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhash
    tanlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsd
    svfsgfllfpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wnuF (F:)
    kfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhashta
    nlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsdsv
    fsgfllfpd