PDB entry 2wne

View 2wne on RCSB PDB site
Description: mutant laminarinase 16a cyclizes laminariheptaose
Deposited on 2009-07-09, released 2010-01-26
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative laminarinase
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q874E3 (0-297)
      • engineered mutation (114)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2wneA (A:)
    atyhlednwvgsaflstftheaiadpthgrvnyvdqatalaknltyasgdtlilradhtt
    tlspsgpgrnsvrirsiktytthvavfdvrhmpqgcgtwpaawetdegdwpnggsvdiie
    gvndqspnamtlhtgancampasrtmtghatnnncdvntdgntgcgvqaptansygpsfn
    angggwyamertnsfikvwffprnagnvpndiasgpatintdnwgtptaffpntncdigs
    hfdanniiinltfcgdwagqasifngagcpgscvdyvnnnpsafanaywdiasvrvyq