PDB entry 2wn8

View 2wn8 on RCSB PDB site
Description: structural basis for substrate recognition in the enzymatic component of ADP-ribosyltransferase toxin cdta from clostridium difficile
Class: transferase
Keywords: cdta, actin-adprt, transferase, binary toxin, ribosyltransferase
Deposited on 2009-07-07, released 2009-08-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-10-20, with a file datestamp of 2009-10-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.22286
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosyltransferase enzymatic component
    Species: Clostridium difficile [TaxId:1496]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2wn8a1, d2wn8a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wn8A (A:)
    mkkfrkhkrisncisillilyltlggllpnniyaqdlqsysekvcnttykapierpedfl
    kdkekakewerkeaerieqklersekealesykkdsveiskysqtrnyfydyqieansre
    keykelrnaisknkidkpmyvyyfespekfafnkvirtenqneislekfnefketiqnkl
    fkqdgfkdislyepgkgdekptpllmhlklprntgmlpytntnnvstlieqgysikidki
    vrividgkhyikaeasvvssldfkddvskgdswgkanyndwsnkltpneladvndymrgg
    ytainnylisngpvnnpnpeldskitnienalkrepiptnltvyrrsgpqefgltltspe
    ydfnklenidafkskwegqalsypnfistsigsvnmsafakrkivlritipkgspgayls
    aipgyageyevllnhgskfkinkidsykdgtitklivdatlip
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wn8A (A:)
    ewerkeaerieqklersekealesykkdsveiskysqtrnyfydyqieansrekeykelr
    naisknkidkpmyvyyfespekfafnkvirtenqneislekfnefketiqnklfkqdgfk
    dislyepgkgdekptpllmhlklprntgmlpytvstlieqgysikidkivrividgkhyi
    kaeasvvssldfkddvskgdswgkanyndwsnkltpneladvndymrggytainnylisn
    gpvnnpnpeldskitnienalkrepiptnltvyrrsgpqefgltltspeydfnklenida
    fkskwegqalsypnfistsigsvnmsafakrkivlritipkgspgaylsaipgeyevlln
    hgskfkinkidsykdgtitklivdatlip