PDB entry 2wn6

View 2wn6 on RCSB PDB site
Description: structural basis for substrate recognition in the enzymatic component of ADP-ribosyltransferase toxin cdta from clostridium difficile
Class: transferase
Keywords: cdta, actin-adprt, transferase, binary toxin, ribosyltransferase
Deposited on 2009-07-07, released 2009-08-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-10-20, with a file datestamp of 2009-10-16.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.20739
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosyltransferase enzymatic component
    Species: Clostridium difficile [TaxId:1496]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KH42 (Start-462)
      • conflict (191)
    Domains in SCOPe 2.04: d2wn6a1, d2wn6a2
  • Heterogens: NDP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wn6A (A:)
    mkkfrkhkrisncisillilyltlggllpnniyaqdlqsysekvcnttykapierpedfl
    kdkekakewerkeaerieqklersekealesykkdsveiskysqtrnyfydyqieansre
    keykelrnaisknkidkpmyvyyfespekfafnkvirtenqneislekfnefketiqnkl
    fkqdgfkdislwepgkgdekptpllmhlklprntgmlpytntnnvstlieqgysikidki
    vrividgkhyikaeasvvssldfkddvskgdswgkanyndwsnkltpneladvndymrgg
    ytainnylisngpvnnpnpeldskitnienalkrepiptnltvyrrsgpqefgltltspe
    ydfnklenidafkskwegqalsypnfistsigsvnmsafakrkivlritipkgspgayls
    aipgyageyevllnhgskfkinkidsykdgtitklivdatlip
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wn6A (A:)
    lkdkekakewerkeaerieqklersekealesykkdsveiskysqtrnyfydyqieansr
    ekeykelrnaisknkidkpmyvyyfespekfafnkvirtenqneislekfnefketiqnk
    lfkqdgfkdislwepgkgdekptpllmhlklprntgmlpytntnnvstlieqgysikidk
    ivrividgkhyikaeasvvssldfkddvskgdswgkanyndwsnkltpneladvndymrg
    gytainnylisngpvnnpnpeldskitnienalkrepiptnltvyrrsgpqefgltltsp
    eydfnklenidafkskwegqalsypnfistsigsvnmsafakrkivlritipkgspgayl
    saipgyageyevllnhgskfkinkidsykdgtitklivdatlip