PDB entry 2wmz

View 2wmz on RCSB PDB site
Description: structure of a mutated tolc
Class: membrane protein
Keywords: membrane protein, type-I secretion, cell outer membrane, transport, drug-efflux
Deposited on 2009-07-03, released 2011-01-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.258
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: outer membrane protein tolc
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02930 (0-427)
      • see remark 999 (168)
      • engineered mutation (366)
    Domains in SCOPe 2.06: d2wmza_
  • Chain 'B':
    Compound: outer membrane protein tolc
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02930 (0-427)
      • see remark 999 (168)
      • engineered mutation (366)
    Domains in SCOPe 2.06: d2wmzb_
  • Chain 'C':
    Compound: outer membrane protein tolc
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02930 (0-427)
      • see remark 999 (168)
      • engineered mutation (366)
    Domains in SCOPe 2.06: d2wmzc_
  • Heterogens: CL, PGE, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wmzA (A:)
    enlmqvyqqarlsnpelrksaadrdaafekinearspllpqlglgadytysngyrdangi
    nsnatsaslqltqsifdmskwraltlqekaagiqdvtyqtdqqtlilntatayfnvlnai
    dvlsytqaqkeaiyrqldqttqrfnvglvaitdvqnaraqydtvlaneltarnnldnave
    qlrqitgnyypelaalnvenfktdkpqpvnallkeaekrnlsllqarlsqdlareqirqa
    qdghlptldltastgisdtsysgsktrgaagtqyddsnmgqnkvglsfslpiyqggmvns
    qvkqaqynfvgaseqlesahrsvvqtvrssfnninasissinaykqavvsaqssldamea
    gysvgtstivdvldatttlynakqelanarynylinqlniksalgtlneqdllalnnals
    kpvstnpe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wmzB (B:)
    enlmqvyqqarlsnpelrksaadrdaafekinearspllpqlglgadytysngyrdangi
    nsnatsaslqltqsifdmskwraltlqekaagiqdvtyqtdqqtlilntatayfnvlnai
    dvlsytqaqkeaiyrqldqttqrfnvglvaitdvqnaraqydtvlaneltarnnldnave
    qlrqitgnyypelaalnvenfktdkpqpvnallkeaekrnlsllqarlsqdlareqirqa
    qdghlptldltastgisdtsysgsktrgaagtqyddsnmgqnkvglsfslpiyqggmvns
    qvkqaqynfvgaseqlesahrsvvqtvrssfnninasissinaykqavvsaqssldamea
    gysvgtstivdvldatttlynakqelanarynylinqlniksalgtlneqdllalnnals
    kpvstnpe
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wmzC (C:)
    enlmqvyqqarlsnpelrksaadrdaafekinearspllpqlglgadytysngyrdangi
    nsnatsaslqltqsifdmskwraltlqekaagiqdvtyqtdqqtlilntatayfnvlnai
    dvlsytqaqkeaiyrqldqttqrfnvglvaitdvqnaraqydtvlaneltarnnldnave
    qlrqitgnyypelaalnvenfktdkpqpvnallkeaekrnlsllqarlsqdlareqirqa
    qdghlptldltastgisdtsysgsktrgaagtqyddsnmgqnkvglsfslpiyqggmvns
    qvkqaqynfvgaseqlesahrsvvqtvrssfnninasissinaykqavvsaqssldamea
    gysvgtstivdvldatttlynakqelanarynylinqlniksalgtlneqdllalnnals
    kpvstnpe