PDB entry 2wmx

View 2wmx on RCSB PDB site
Description: crystal structure of checkpoint kinase 1 (chk1) in complex with inhibitors
Class: transferase
Keywords: serine/threonine-protein kinase, phosphoprotein, isopeptide bond, checkpoint kinase, nucleotide-binding, serine/threonine kinase, DNA damage, DNA repair, ATP-binding, transferase, chk1, kinase, nucleus, cell cycle
Deposited on 2009-07-03, released 2009-07-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.22
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2wmxa_
  • Heterogens: ZY6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wmxA (A:)
    mavpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicink
    mlnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvy
    lhgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellk
    rrefhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsapla
    llhkilvenpsaritipdikkdrwynkplkkgakrprvtsggvsespsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wmxA (A:)
    edwdlvqtlgevqlavnrvteeavavkivdmnikkeicinkmlnhenvvkfyghrreiqy
    lfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigithrdikpenlllder
    dnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepvdvwscgivltam
    lagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilvenpsaritipdikk
    drwynkpl