PDB entry 2wmo

View 2wmo on RCSB PDB site
Description: structure of the complex between dock9 and cdc42.
Class: cell cycle
Keywords: polymorphism, cell membrane, phosphoprotein, nucleotide-binding, alternative splicing, guanine-nucleotide releasing factor, cell cycle, methylation, lipoprotein, coiled coil, GTP-binding, gefs, dock9, cdc42, membrane, prenylation
Deposited on 2009-07-02, released 2009-09-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-09-22, with a file datestamp of 2009-09-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2188
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dedicator of cytokinesis protein 9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BZ29 (48-425)
    • PDB 2WMO (426-End)
  • Chain 'B':
    Compound: Cell division control protein 42 homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WMO (Start-1)
    • Uniprot P60953 (2-End)
    Domains in SCOPe 2.08: d2wmob_
  • Heterogens: GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wmoB (B:)
    shmqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdt
    agqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqid
    lrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale
    ppepkksrrc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wmoB (B:)
    hmqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdta
    gqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidl
    rddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal