PDB entry 2wmn

View 2wmn on RCSB PDB site
Description: structure of the complex between dock9 and cdc42-GDP.
Class: cell cycle
Keywords: cell cycle, alternative splicing, methylation, prenylation, lipoprotein, coiled coil, gefs, dock9, cdc42, membrane, nucleotide, phosphoprotein, nucleotide-binding, GTP-binding, polymorphism, cell membrane, guanine-nucleotide releasing factor
Deposited on 2009-07-02, released 2009-09-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-09-22, with a file datestamp of 2009-09-18.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.2225
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dedicator of cytokinesis protein 9
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BZ29 (48-425)
    • PDB 2WMN (426-End)
  • Chain 'B':
    Compound: Cell division control protein 42 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2WMN (0-1)
    • Uniprot P60953 (2-End)
    Domains in SCOPe 2.01: d2wmnb_
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wmnB (B:)
    shmqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdt
    agqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqid
    lrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale
    ppepkksrrc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wmnB (B:)
    shmqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdt
    agqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqid
    lrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal