PDB entry 2wmm

View 2wmm on RCSB PDB site
Description: crystal structure of the hinge domain of mukb
Deposited on 2009-07-01, released 2010-01-12
The last revision was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chromosome partition protein mukb
    Species: Escherichia coli [TaxId:83333]
    Gene: mukB, b0924, JW0907
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22523 (2-161)
      • expression tag (0-1)
      • engineered mutation (9)
  • Chain 'B':
    Compound: chromosome partition protein mukb
    Species: Escherichia coli [TaxId:83333]
    Gene: mukB, b0924, JW0907
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22523 (2-161)
      • expression tag (0-1)
      • engineered mutation (9)
  • Heterogens: MLT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2wmmA (A:)
hmerdevgahknavdeeierlsqpggsedqrlnalaerfggvllseiyddvsledapyfs
alygpsrhaivvpdlsqvtehlegltdcpedlyliegdpqsfddsvfsvdelekavvvki
adrqwrysrfpevplfgraaresrieslhaerevlserfatl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2wmmB (B:)
hmerdevgahknavdeeierlsqpggsedqrlnalaerfggvllseiyddvsledapyfs
alygpsrhaivvpdlsqvtehlegltdcpedlyliegdpqsfddsvfsvdelekavvvki
adrqwrysrfpevplfgraaresrieslhaerevlserfatl