PDB entry 2wmk

View 2wmk on RCSB PDB site
Description: Crystal structure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae SP3-BS71 (Sp3GH98) in complex with the A-LewisY pentasaccharide blood group antigen.
Class: hydrolase
Keywords: blood group, antigen, fucose utilization, hydrolase
Deposited on 2009-06-30, released 2009-07-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.16481
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fucolectin-related protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:406556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5LBQ0 (Start-605)
      • engineered mutation (160)
    Domains in SCOPe 2.06: d2wmka1, d2wmka2
  • Chain 'B':
    Compound: fucolectin-related protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:406556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5LBQ0 (Start-605)
      • engineered mutation (160)
    Domains in SCOPe 2.06: d2wmkb1, d2wmkb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wmkA (A:)
    mgsshhhhhhssglvprgshmasevdkrreinnehpllmmplyangeefnqgkytfwggd
    tltgkwenipddlkpytviqlhpddlpkrdgaardfyehmleeaakyvnpktgknepipv
    iltvytagnmpyytsahwlstswidkmyqkypnlhgifstanywiwandienkaadylkv
    saknggyfiwaeqnngsaiekafgkngkiafqksvdkywknlifmfkntpaaegndstte
    symkglwlsnhtyqwgglmdtwkwyetgkwklfasgnigksqgdrqwltepesmlgeeal
    gvylnggvvynfehpaytygvnnkesllfsevikeffryviahpapskekvledtkvfih
    gdysnkgngkffvnvntdreqtplymtgrynvipaipgvlktdklkesvsssriqikeit
    spefsstqarkeylnklypmnyegdifaqkldnrwfvynykvnenvkqtgklkfnslemn
    vefephtygiferisnglkvnlnnfrtnkdslwsnaqdanqakklpqltkkgaikwieeh
    yikdtqfgekrvtkivlrgidklptihslsgtnnsydqpslnfdqknhmvtitinsngnl
    efelhf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wmkA (A:)
    vdkrreinnehpllmmplyangeefnqgkytfwggdtltgkwenipddlkpytviqlhpd
    dlpkrdgaardfyehmleeaakyvnpktgknepipviltvytagnmpyytsahwlstswi
    dkmyqkypnlhgifstanywiwandienkaadylkvsaknggyfiwaeqnngsaiekafg
    kngkiafqksvdkywknlifmfkntpaaegndsttesymkglwlsnhtyqwgglmdtwkw
    yetgkwklfasgnigksqgdrqwltepesmlgeealgvylnggvvynfehpaytygvnnk
    esllfsevikeffryviahpapskekvledtkvfihgdysnkgngkffvnvntdreqtpl
    ymtgrynvipaipgvlktdiqikeitspefsstqarkeylnklypmnyegdifaqkldnr
    wfvynykvnenvkqtgklkfnslemnvefephtygiferisnglkvnlnnfrtnkdslws
    naqdanqakklpqltkkgaikwieehyikdtqfgekrvtkivlrgidklptihslsgtnn
    sydqpslnfdqknhmvtitinsngnlefelhf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wmkB (B:)
    mgsshhhhhhssglvprgshmasevdkrreinnehpllmmplyangeefnqgkytfwggd
    tltgkwenipddlkpytviqlhpddlpkrdgaardfyehmleeaakyvnpktgknepipv
    iltvytagnmpyytsahwlstswidkmyqkypnlhgifstanywiwandienkaadylkv
    saknggyfiwaeqnngsaiekafgkngkiafqksvdkywknlifmfkntpaaegndstte
    symkglwlsnhtyqwgglmdtwkwyetgkwklfasgnigksqgdrqwltepesmlgeeal
    gvylnggvvynfehpaytygvnnkesllfsevikeffryviahpapskekvledtkvfih
    gdysnkgngkffvnvntdreqtplymtgrynvipaipgvlktdklkesvsssriqikeit
    spefsstqarkeylnklypmnyegdifaqkldnrwfvynykvnenvkqtgklkfnslemn
    vefephtygiferisnglkvnlnnfrtnkdslwsnaqdanqakklpqltkkgaikwieeh
    yikdtqfgekrvtkivlrgidklptihslsgtnnsydqpslnfdqknhmvtitinsngnl
    efelhf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wmkB (B:)
    vdkrreinnehpllmmplyangeefnqgkytfwggdtltgkwenipddlkpytviqlhpd
    dlpkrdgaardfyehmleeaakyvnpktgknepipviltvytagnmpyytsahwlstswi
    dkmyqkypnlhgifstanywiwandienkaadylkvsaknggyfiwaeqnngsaiekafg
    kngkiafqksvdkywknlifmfkntpaaegndsttesymkglwlsnhtyqwgglmdtwkw
    yetgkwklfasgnigksqgdrqwltepesmlgeealgvylnggvvynfehpaytygvnnk
    esllfsevikeffryviahpapskekvledtkvfihgdysnkgngkffvnvntdreqtpl
    ymtgrynvipaipgvlktdriqikeitspefsstqarkeylnklypmnyegdifaqkldn
    rwfvynykvnenvkqtgklkfnslemnvefephtygiferisnglkvnlnnfrtnkdslw
    snaqdanqakklpqltkkgaikwieehyikdtqfgekrvtkivlrgidklptihslsgtn
    nsydqpslnfdqknhmvtitinsngnlefelhf