PDB entry 2wlq

View 2wlq on RCSB PDB site
Description: nucleophile-disabled lam16a mutant holds laminariheptaose (l7) in a cyclical conformation
Deposited on 2009-06-24, released 2010-01-26
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative laminarinase
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q874E3 (0-297)
      • engineered mutation (114)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2wlqA (A:)
atyhlednwvgsaflstftheaiadpthgrvnyvdqatalaknltyasgdtlilradhtt
tlspsgpgrnsvrirsiktytthvavfdvrhmpqgcgtwpaawetdegdwpnggsvdiie
gvndqspnamtlhtgancampasrtmtghatnnncdvntdgntgcgvqaptansygpsfn
angggwyamertnsfikvwffprnagnvpndiasgpatintdnwgtptaffpntncdigs
hfdanniiinltfcgdwagqasifngagcpgscvdyvnnnpsafanaywdiasvrvyq