PDB entry 2wlk

View 2wlk on RCSB PDB site
Description: structure of the ATP-sensitive inward rectifier potassium channel from magnetospirillum magnetotacticum
Class: metal transport
Keywords: integral membrane protein, ionic channel, metal transport, ion transport, transport
Deposited on 2009-06-24, released 2010-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.24836
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-sensitive inward rectifier potassium channel 10
    Species: Magnetospirillum magnetotacticum [TaxId:188]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WLK (295-300)
    Domains in SCOPe 2.07: d2wlka1, d2wlka2, d2wlka3
  • Chain 'B':
    Compound: ATP-sensitive inward rectifier potassium channel 10
    Species: Magnetospirillum magnetotacticum [TaxId:188]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WLK (295-300)
    Domains in SCOPe 2.07: d2wlkb1, d2wlkb2, d2wlkb3
  • Heterogens: K, CL, SPM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wlkA (A:)
    mtggmkpparkprilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvt
    nalfalaylacgdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcg
    mlglavaasliyarftrptagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvl
    vrseisqegmvfrrfhdltltrsrspifslswtvmhpidhhspiygetdetlrnshsefl
    vlftghheafaqnvharhayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wlkA (A:)
    kprilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalayla
    cgdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasl
    iyarftrptagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegm
    vfrrfhdltltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheaf
    aqnvharhayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wlkB (B:)
    mtggmkpparkprilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvt
    nalfalaylacgdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcg
    mlglavaasliyarftrptagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvl
    vrseisqegmvfrrfhdltltrsrspifslswtvmhpidhhspiygetdetlrnshsefl
    vlftghheafaqnvharhayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wlkB (B:)
    kprilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalayla
    cgdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasl
    iyarftrptagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegm
    vfrrfhdltltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheaf
    aqnvharhayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhhhh