PDB entry 2wli

View 2wli on RCSB PDB site
Description: potassium channel from magnetospirillum magnetotacticum
Class: metal transport
Keywords: integral membrane protein, ionic channel, metal transport, ion transport, transport
Deposited on 2009-06-24, released 2010-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 3.09 Å
R-factor: 0.26655
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: potassium channel
    Species: Magnetospirillum magnetotacticum [TaxId:188]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WLI (295-End)
    Domains in SCOPe 2.07: d2wlia1, d2wlia2, d2wlia3
  • Chain 'B':
    Compound: kirbac3.1 potassium channel
    Species: Magnetospirillum magnetotacticum [TaxId:188]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WLI (295-End)
    Domains in SCOPe 2.07: d2wlib1, d2wlib2, d2wlib3
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wliA (A:)
    mtggmkpparkprilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvt
    nalfalaylacgdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcg
    mlglavaasliyarftrptagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvl
    vrseisqegmvfrrfhdltrtrsrspifslswtvmhpidhhspiygetdetlrnshsefl
    vlftghheafaqnvharhayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wliA (A:)
    prilnsdgssnitrlgllddhyhdlltvswpvfitlitglylvtnalfalaylacgdvie
    narpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasliyarft
    rptagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfh
    dltrtrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvha
    rhayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wliB (B:)
    mtggmkpparkprilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvt
    nalfalaylacgdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcg
    mlglavaasliyarftrptagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvl
    vrseisqegmvfrrfhdltltrsrspifslswtvmhpidhhspiygetdetlrnshsefl
    vlftghheafaqnvharhayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wliB (B:)
    itrlglddhyhdlltvswpvfitlitglylvtnalfalaylacgdvienarpgsftdaff
    fsvqtmatigygklipigplantlvtlealcgmlglavaasliyarftrptagvlfssrm
    visdfegkptlmmrlanlrieqiieadvhlvlvrserrfhdltltrsrspifslswtvmh
    pidhhspiygetdetlrnshseflvlftghheafaqnvharhayscdeiiwgghfvdvft
    tlpdgrraldlgkfheiaqhhhh