PDB entry 2wlb

View 2wlb on RCSB PDB site
Description: adrenodoxin-like ferredoxin etp1fd(516-618) of schizosaccharomyces pombe mitochondria
Class: electron transport
Keywords: iron-sulfur, mitochondria, iron, transport, ferredoxin, adrenodoxin-like, electron transport, metal-binding
Deposited on 2009-06-23, released 2010-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.184
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: electron transfer protein 1, mitochondrial
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wlba_
  • Chain 'B':
    Compound: electron transfer protein 1, mitochondrial
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wlbb_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wlbA (A:)
    gtgikvffvtpegreimiegnegdsildlahannidlegacegsvacstchvivdpehye
    lldppeedeedmldlafgleetsrlgcqvllrkdldgirvrip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wlbB (B:)
    gtgikvffvtpegreimiegnegdsildlahannidlegacegsvacstchvivdpehye
    lldppeedeedmldlafgleetsrlgcqvllrkdldgirvrip
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wlbB (B:)
    gikvffvtpegreimiegnegdsildlahannidlegacegsvacstchvivdpehyell
    dppeedeedmldlafgleetsrlgcqvllrkdldgirvrip