PDB entry 2wko

View 2wko on RCSB PDB site
Description: structure of metal loaded pathogenic sod1 mutant g93a.
Class: oxidoreductase
Keywords: amyotrophic lateral sclerosis, phosphoprotein, oxidoreductase, disease mutation, neurodegeneration, acetylation, antioxidant, metal-binding
Deposited on 2009-06-16, released 2009-11-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-12-08, with a file datestamp of 2009-12-04.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.17666
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WKO
      • engineered mutation (92)
    • Uniprot P00441 (0-152)
    Domains in SCOPe 2.08: d2wkoa_
  • Chain 'F':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WKO
      • engineered mutation (92)
    • Uniprot P00441 (0-152)
    Domains in SCOPe 2.08: d2wkof_
  • Heterogens: CU, ZN, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wkoA (A:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wkoF (F:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq