PDB entry 2wkm

View 2wkm on RCSB PDB site
Description: x-ray structure of pha-00665752 bound to the kinase domain of c-met
Class: transferase
Keywords: hepatocyte growth factor receptor, c-met, kinase, inhibitor, transferase
Deposited on 2009-06-15, released 2010-08-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2183
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2wkma_
  • Heterogens: PFY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wkmA (A:)
    mvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcav
    kslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfi
    rnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardm
    ydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvnt
    fditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehh
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wkmA (A:)
    npelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavkslnritdi
    gevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethnptv
    kdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyysvh
    nktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllq
    grrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfi