PDB entry 2wk6

View 2wk6 on RCSB PDB site
Description: structural features of native human thymidine phosphorylase and in complex with 5-iodouracil
Class: transferase
Keywords: glycosyltransferase, developmental protein, angiogenesis, 5-iodouracil, growth factor, enzyme kinetics, differentiation, disease mutation, thymidine phosphorylase, chemotaxis, transferase, mutagenesis, polymorphism
Deposited on 2009-06-05, released 2009-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-28, with a file datestamp of 2009-07-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.227
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidine phosphorylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wk6a1, d2wk6a2, d2wk6a3
  • Chain 'B':
    Compound: thymidine phosphorylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wk6b1, d2wk6b2, d2wk6b3
  • Heterogens: IUR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wk6A (A:)
    maalmtpgtgappapgdfsgegsqglpdpspepkqlpelirmkrdggrlseadirgfvaa
    vvngsaqgaqigamlmairlrgmdleetsvltqalaqsgqqlewpeawrqqlvdkhstgg
    vgdkvslvlapalaacgckvpmisgrglghtggtldklesipgfnviqspeqmqvlldqa
    gccivgqseqlvpadgilyaardvtatvdslplitasilskklveglsalvvdvkfggaa
    vfpnqeqarelaktlvgvgaslglrvaaaltamdkplgrcvghaleveeallcmdgagpp
    dlrdlvttlggallwlsghagtqaqgaarvaaalddgsalgrfermlaaqgvdpglaral
    csgspaerrqllprareqeellapadgtvelvralplalvlhelgagrsrageplrlgvg
    aellvdvgqrlrrgtpwlrvhrdgpalsgpqsralqealvlsdrapfaapspfaelvlpp
    qq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wk6A (A:)
    qlpelirmkrdggrlseadirgfvaavvngsaqgaqigamlmairlrgmdleetsvltqa
    laqsgqqlewpeawrqqlvdkhstggvgdkvslvlapalaacgckvpmisgrglghtggt
    ldklesipgfnviqspeqmqvlldqagccivgqseqlvpadgilyaardvtatvdslpli
    tasilskklveglsalvvdvkfggaavfpnqeqarelaktlvgvgaslglrvaaaltamd
    kplgrcvghaleveeallcmdgagppdlrdlvttlggallwlsghagtqaqgaarvaaal
    ddgsalgrfermlaaqgvdpglaralcsgspaerrqllprareqeellapadgtvelvra
    lplalvlhelgagrsrageplrlgvgaellvdvgqrlrrgtpwlrvhrdgpalsgpqsra
    lqealvlsdrapfaapspfaelvlppq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wk6B (B:)
    maalmtpgtgappapgdfsgegsqglpdpspepkqlpelirmkrdggrlseadirgfvaa
    vvngsaqgaqigamlmairlrgmdleetsvltqalaqsgqqlewpeawrqqlvdkhstgg
    vgdkvslvlapalaacgckvpmisgrglghtggtldklesipgfnviqspeqmqvlldqa
    gccivgqseqlvpadgilyaardvtatvdslplitasilskklveglsalvvdvkfggaa
    vfpnqeqarelaktlvgvgaslglrvaaaltamdkplgrcvghaleveeallcmdgagpp
    dlrdlvttlggallwlsghagtqaqgaarvaaalddgsalgrfermlaaqgvdpglaral
    csgspaerrqllprareqeellapadgtvelvralplalvlhelgagrsrageplrlgvg
    aellvdvgqrlrrgtpwlrvhrdgpalsgpqsralqealvlsdrapfaapspfaelvlpp
    qq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wk6B (B:)
    qlpelirmkrdggrlseadirgfvaavvngsaqgaqigamlmairlrgmdleetsvltqa
    laqsgqqlewpeawrqqlvdkhstggvgdkvslvlapalaacgckvpmisgrglghtggt
    ldklesipgfnviqspeqmqvlldqagccivgqseqlvpadgilyaardvtatvdslpli
    tasilskklveglsalvvdvkfggaavfpnqeqarelaktlvgvgaslglrvaaaltamd
    kplgrcvghaleveeallcmdgagppdlrdlvttlggallwlsghagtqaqgaarvaaal
    ddgsalgrfermlaaqgvdpglaralcsgspaerrqllprareqeellapadgtvelvra
    lplalvlhelgagrsrageplrlgvgaellvdvgqrlrrgtpwlrvhrdgpalsgpqsra
    lqealvlsdrapfaapspfaelvlppq