PDB entry 2wjp

View 2wjp on RCSB PDB site
Description: crystal structure of murd ligase in complex with d-glu containing rhodanine inhibitor
Class: ligase
Keywords: peptidoglycan synthesis, cell wall biogenesis/degradation, cell cycle, cell division, ligase, cell shape synthesis
Deposited on 2009-05-28, released 2010-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.167
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylmuramoylalanine--d-glutamate ligase
    Species: ESCHERICHIA COLI DH5[ALPHA] [TaxId:668369]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14900 (0-436)
      • expression tag (437-438)
    Domains in SCOPe 2.07: d2wjpa1, d2wjpa2, d2wjpa3, d2wjpa4
  • Heterogens: D17, DMS, AZI, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wjpA (A:)
    adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
    wlmaadlivaspgialahpslsaaadagieivgdielfcreaqapivaitgsngkstvtt
    lvgemakaagvnvgvggniglpalmllddecelyvlelssfqlettsslqavaatilnvt
    edhmdrypfglqqyraaklriyenakvcvvnaddaltmpirgadercvsfgvnmgdyhln
    hqqgetwlrvkgekvlnvkemklsgqhnytnalaalaladaaglprasslkalttftglp
    hrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplaryln
    gdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasldqfk
    nfeqrgnefarlakelgsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wjpA (A:)
    adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
    wlmaadlivaspgialahpslsaaadagieivgdielfcreaqapivaitgsngkstvtt
    lvgemakaagvnvgvggniglpalmllddecelyvlelssfqlettsslqavaatilnvt
    edhmdrypfglqqyraaklriyenakvcvvnaddaltmpirrcvsfgvnmgdyhlnhqqg
    etwlrvkgekvlnvkemklsgqhnytnalaalaladaaglprasslkalttftglphrfe
    vvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplarylngdnv
    rlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasldqfknfeq
    rgnefarlakelgsh