PDB entry 2wjh
View 2wjh on RCSB PDB site
Description: structure and function of the feob g-domain from methanococcus jannaschii
Class: metal transport
Keywords: metal transport, membrane g-proteins, ferrous iron transport, cell membrane, ion transport, transmembrane, nucleotide binding motifs, iron, gnbps, membrane, transport, GTP-binding, iron transport, nucleotide-binding
Deposited on
2009-05-26, released
2009-07-28
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-05-25, with a file datestamp of
2011-05-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2122
AEROSPACI score: 0.39
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ferrous iron transport protein b homolog
Species: Methanocaldococcus jannaschii [TaxId:2190]
Database cross-references and differences (RAF-indexed):
- Uniprot Q57986 (0-164)
- PDB 2WJH (165-165)
Domains in SCOPe 2.08: d2wjha_ - Chain 'B':
Compound: ferrous iron transport protein b homolog
Species: Methanocaldococcus jannaschii [TaxId:2190]
Database cross-references and differences (RAF-indexed):
- Uniprot Q57986 (0-164)
- PDB 2WJH (165-165)
Domains in SCOPe 2.08: d2wjhb_ - Heterogens: GDP, MG, FLC, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2wjhA (A:)
mksyeialignpnvgkstifnaltgenvyignwpgvtvekkegefeyngekfkvvdlpgv
ysltansideiiardyiinekpdlvvnivdatalernlyltlqlmemganlllalnkmdl
akslgieidvdklekilgvkvvplsaakkmgieelkkaisiavkdl
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2wjhB (B:)
mksyeialignpnvgkstifnaltgenvyignwpgvtvekkegefeyngekfkvvdlpgv
ysltansideiiardyiinekpdlvvnivdatalernlyltlqlmemganlllalnkmdl
akslgieidvdklekilgvkvvplsaakkmgieelkkaisiavkdl