PDB entry 2wjh

View 2wjh on RCSB PDB site
Description: structure and function of the feob g-domain from methanococcus jannaschii
Class: metal transport
Keywords: metal transport, membrane g-proteins, ferrous iron transport, cell membrane, ion transport, transmembrane, nucleotide binding motifs, iron, gnbps, membrane, transport, GTP-binding, iron transport, nucleotide-binding
Deposited on 2009-05-26, released 2009-07-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2122
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferrous iron transport protein b homolog
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57986 (0-164)
      • conflict (153)
    • PDB 2WJH (165-165)
    Domains in SCOPe 2.08: d2wjha_
  • Chain 'B':
    Compound: ferrous iron transport protein b homolog
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57986 (0-164)
      • conflict (153)
    • PDB 2WJH (165-165)
    Domains in SCOPe 2.08: d2wjhb_
  • Heterogens: GDP, MG, FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wjhA (A:)
    mksyeialignpnvgkstifnaltgenvyignwpgvtvekkegefeyngekfkvvdlpgv
    ysltansideiiardyiinekpdlvvnivdatalernlyltlqlmemganlllalnkmdl
    akslgieidvdklekilgvkvvplsaakkmgieelkkaisiavkdl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2wjhB (B:)
    mksyeialignpnvgkstifnaltgenvyignwpgvtvekkegefeyngekfkvvdlpgv
    ysltansideiiardyiinekpdlvvnivdatalernlyltlqlmemganlllalnkmdl
    akslgieidvdklekilgvkvvplsaakkmgieelkkaisiavkdl