PDB entry 2wj6

View 2wj6 on RCSB PDB site
Description: crystal structure of the cofactor-devoid 1-h-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase (hod) from arthrobacter nitroguajacolicus ru61a complexed with its natural product n-acetylanthranilate
Deposited on 2009-05-22, released 2010-01-26
The last revision was dated 2010-07-07, with a file datestamp of 2010-07-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18045
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1h-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase
    Species: ARTHROBACTER NITROGUAJACOLICUS [TaxId:211146]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4V8M9
      • engineered mutation (68)
  • Chain 'B':
    Compound: 1h-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase
    Species: ARTHROBACTER NITROGUAJACOLICUS [TaxId:211146]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4V8M9
      • engineered mutation (68)
  • Chain 'C':
    Compound: 1h-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase
    Species: ARTHROBACTER NITROGUAJACOLICUS [TaxId:211146]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4V8M9
      • engineered mutation (68)
  • Chain 'D':
    Compound: 1h-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase
    Species: ARTHROBACTER NITROGUAJACOLICUS [TaxId:211146]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4V8M9
      • engineered mutation (68)
  • Heterogens: GOL, K, ZZ8, SRT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2wj6A (A:)
    mtdtylhetlvfdnklsyidnqrdtdgpailllpgwchdhrvykyliqeldadfrvivpn
    wrghglspsevpdfgyqeqvkdaleildqlgvetflpvshshggwvlvelleqagperap
    rgiimdwlmwapkpdfaksltllkdperwregthglfdvwldghdekrvrhhlleemady
    gydcwgrsgrviedaygrngspmqmmanltktrpirhifsqptepeyekinsdfaeqhpw
    fsyaklggpthfpaidvpdraavhirefatairqgq
    

    Sequence, based on observed residues (ATOM records):
    >2wj6A (A:)
    tdtylhetlvfdnklsyidnqrdtdgpailllpgwchdhrvykyliqeldadfrvivpnw
    rghglspsevpdfgyqeqvkdaleildqlgvetflpvshshggwvlvelleqagperapr
    giimdwlmwapkpdfaksltllkdperwregthglfdvwldghdekrvrhhlleemadyg
    ydcwgrsgrviedaygrngspmqmmanltktrpirhifsqptepeyekinsdfaeqhpwf
    syaklggpthfpaidvpdraavhirefatairqg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2wj6B (B:)
    mtdtylhetlvfdnklsyidnqrdtdgpailllpgwchdhrvykyliqeldadfrvivpn
    wrghglspsevpdfgyqeqvkdaleildqlgvetflpvshshggwvlvelleqagperap
    rgiimdwlmwapkpdfaksltllkdperwregthglfdvwldghdekrvrhhlleemady
    gydcwgrsgrviedaygrngspmqmmanltktrpirhifsqptepeyekinsdfaeqhpw
    fsyaklggpthfpaidvpdraavhirefatairqgq
    

    Sequence, based on observed residues (ATOM records):
    >2wj6B (B:)
    tdtylhetlvfdnklsyidnqrdtdgpailllpgwchdhrvykyliqeldadfrvivpnw
    rghglspsevpdfgyqeqvkdaleildqlgvetflpvshshggwvlvelleqagperapr
    giimdwlmwapkpdfaksltllkdperwregthglfdvwldghdekrvrhhlleemadyg
    ydcwgrsgrviedaygrngspmqmmanltktrpirhifsqptepeyekinsdfaeqhpwf
    syaklggpthfpaidvpdraavhirefatairqg
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >2wj6C (C:)
    mtdtylhetlvfdnklsyidnqrdtdgpailllpgwchdhrvykyliqeldadfrvivpn
    wrghglspsevpdfgyqeqvkdaleildqlgvetflpvshshggwvlvelleqagperap
    rgiimdwlmwapkpdfaksltllkdperwregthglfdvwldghdekrvrhhlleemady
    gydcwgrsgrviedaygrngspmqmmanltktrpirhifsqptepeyekinsdfaeqhpw
    fsyaklggpthfpaidvpdraavhirefatairqgq
    

    Sequence, based on observed residues (ATOM records):
    >2wj6C (C:)
    tdtylhetlvfdnklsyidnqrdtdgpailllpgwchdhrvykyliqeldadfrvivpnw
    rghglspsevpdfgyqeqvkdaleildqlgvetflpvshshggwvlvelleqagperapr
    giimdwlmwapkpdfaksltllkdperwregthglfdvwldghdekrvrhhlleemadyg
    ydcwgrsgrviedaygrngspmqmmanltktrpirhifsqptepeyekinsdfaeqhpwf
    syaklggpthfpaidvpdraavhirefatairq
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >2wj6D (D:)
    mtdtylhetlvfdnklsyidnqrdtdgpailllpgwchdhrvykyliqeldadfrvivpn
    wrghglspsevpdfgyqeqvkdaleildqlgvetflpvshshggwvlvelleqagperap
    rgiimdwlmwapkpdfaksltllkdperwregthglfdvwldghdekrvrhhlleemady
    gydcwgrsgrviedaygrngspmqmmanltktrpirhifsqptepeyekinsdfaeqhpw
    fsyaklggpthfpaidvpdraavhirefatairqgq
    

    Sequence, based on observed residues (ATOM records):
    >2wj6D (D:)
    tdtylhetlvfdnklsyidnqrdtdgpailllpgwchdhrvykyliqeldadfrvivpnw
    rghglspsevpdfgyqeqvkdaleildqlgvetflpvshshggwvlvelleqagperapr
    giimdwlmwapkpdfaksltllkdperwregthglfdvwldghdekrvrhhlleemadyg
    ydcwgrsgrviedaygrngspmqmmanltktrpirhifsqptepeyekinsdfaeqhpwf
    syaklggpthfpaidvpdraavhirefatairq