PDB entry 2wis

View 2wis on RCSB PDB site
Description: fluorescent protein killerred in the bleached state
Class: fluorescent protein
Keywords: fluorescent protein, cali, ros, reactive oxygen species
Deposited on 2009-05-15, released 2009-08-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-08, with a file datestamp of 2009-09-04.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.226
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KillerRed
    Species: Anthomedusae sp. DC-2005 [TaxId:328397]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WIS
      • chromophore (86)
    • Uniprot Q2TCH5 (23-End)
    Domains in SCOPe 2.06: d2wisa_
  • Chain 'B':
    Compound: KillerRed
    Species: Anthomedusae sp. DC-2005 [TaxId:328397]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WIS
      • chromophore (86)
    • Uniprot Q2TCH5 (23-End)
    Domains in SCOPe 2.06: d2wisb_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wisA (A:)
    mgsshhhhhhssglvprgshmgseggpalfqsdmtfkifidgevngqkftivadgsskfp
    hgdfnvhavcetgklpmswkpichliqygepffarypdgishfaqecfpeglsidrtvrf
    endgtmtshhtyelddtcvvsritvncdgfqpdgpimrdqlvdilpnethmfphgpnavr
    qlafigfttadgglmmghfdskmtfngsraieipgphfvtiitkqmrdtsdkrdhvcqre
    vayahsvpritsaigsded
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wisA (A:)
    eggpalfqsdmtfkifidgevngqkftivadgsskfphgdfnvhavcetgklpmswkpic
    hliqygepffarypdgishfaqecfpeglsidrtvrfendgtmtshhtyelddtcvvsri
    tvncdgfqpdgpimrdqlvdilpnethmfphgpnavrqlafigfttadgglmmghfdskm
    tfngsraieipgphfvtiitkqmrdtsdkrdhvcqrevayahsvprit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wisB (B:)
    mgsshhhhhhssglvprgshmgseggpalfqsdmtfkifidgevngqkftivadgsskfp
    hgdfnvhavcetgklpmswkpichliqygepffarypdgishfaqecfpeglsidrtvrf
    endgtmtshhtyelddtcvvsritvncdgfqpdgpimrdqlvdilpnethmfphgpnavr
    qlafigfttadgglmmghfdskmtfngsraieipgphfvtiitkqmrdtsdkrdhvcqre
    vayahsvpritsaigsded
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wisB (B:)
    eggpalfqsdmtfkifidgevngqkftivadgsskfphgdfnvhavcetgklpmswkpic
    hliqygepffarypdgishfaqecfpeglsidrtvrfendgtmtshhtyelddtcvvsri
    tvncdgfqpdgpimrdqlvdilpnethmfphgpnavrqlafigfttadgglmmghfdskm
    tfngsraieipgphfvtiitkqmrdtsdkrdhvcqrevayahsvpritsaig