PDB entry 2wie

View 2wie on RCSB PDB site
Description: high-resolution structure of the rotor ring from a proton dependent atp synthase
Deposited on 2009-05-11, released 2009-09-29
The last revision was dated 2011-05-11, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.1984
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP synthase c chain
    Species: Arthrospira platensis [TaxId:118562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ATP synthase c chain
    Species: Arthrospira platensis [TaxId:118562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ATP synthase c chain
    Species: Arthrospira platensis [TaxId:118562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: ATP synthase c chain
    Species: Arthrospira platensis [TaxId:118562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: ATP synthase c chain
    Species: Arthrospira platensis [TaxId:118562]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CVM, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2wieA (A:)
mesnlttaasviaaalavgigsigpglgqgqaagqavegiarqpeaegkirgtlllslaf
mealtiyglvvalvllfanpfv

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2wieB (B:)
mesnlttaasviaaalavgigsigpglgqgqaagqavegiarqpeaegkirgtlllslaf
mealtiyglvvalvllfanpfv

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >2wieC (C:)
mesnlttaasviaaalavgigsigpglgqgqaagqavegiarqpeaegkirgtlllslaf
mealtiyglvvalvllfanpfv

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >2wieD (D:)
mesnlttaasviaaalavgigsigpglgqgqaagqavegiarqpeaegkirgtlllslaf
mealtiyglvvalvllfanpfv

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >2wieE (E:)
mesnlttaasviaaalavgigsigpglgqgqaagqavegiarqpeaegkirgtlllslaf
mealtiyglvvalvllfanpfv