PDB entry 2whw

View 2whw on RCSB PDB site
Description: selective oxidation of carbolide c-h bonds by engineered macrolide p450 monooxygenase
Class: oxidoreductase
Keywords: antibiotic biosynthesis, cyp107l1, cytochrome p450, heme, iron, macrolide monooxygenase, metal-binding, monooxygenase, oxidoreductase, oxidoreductase antibiotic biosynthesis, pikc
Deposited on 2009-05-07, released 2009-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.18
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 monooxygenase
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WHW
      • engineered mutation (69)
    • Uniprot O87605
    Domains in SCOPe 2.07: d2whwa_
  • Chain 'B':
    Compound: cytochrome p450 monooxygenase
    Species: STREPTOMYCES VENEZUELAE [TaxId:54571]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WHW
      • engineered mutation (69)
    • Uniprot O87605
    Domains in SCOPe 2.07: d2whwb_
  • Heterogens: HEM, 1D4, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2whwA (A:)
    mgsshhhhhhssglvpagshmrrtqqgttasppvldlgalgqdfaadpyptyarlraegp
    ahrvrtpegnevwlvvgydraravladprfskdwrnsttplteaeaalnhnmlesdpprh
    trlrklvareftmrrvellrprvqeivdglvdamlaapdgradlmeslawplpitvisel
    lgvpepdraafrvwtdafvfpddpaqaqtamaemsgylsrlidskrgqdgedllsalvrt
    sdedgsrltseellgmahillvaghettvnliangmyallshpdqlaalradmtlldgav
    eemlryegpvesatyrfpvepvdldgtvipagdtvlvvladahrtperfpdphrfdirrd
    taghlafghgihfcigaplarleariavrallercpdlaldvspgelvwypnpmirglka
    lpirwrrgreagrrtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2whwA (A:)
    ppvldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladprfs
    kdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdglv
    damlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqtam
    aemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettvnl
    iangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvipa
    gdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavral
    lercpdlaldvspgelvwypnpmirglkalpirwrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2whwB (B:)
    mgsshhhhhhssglvpagshmrrtqqgttasppvldlgalgqdfaadpyptyarlraegp
    ahrvrtpegnevwlvvgydraravladprfskdwrnsttplteaeaalnhnmlesdpprh
    trlrklvareftmrrvellrprvqeivdglvdamlaapdgradlmeslawplpitvisel
    lgvpepdraafrvwtdafvfpddpaqaqtamaemsgylsrlidskrgqdgedllsalvrt
    sdedgsrltseellgmahillvaghettvnliangmyallshpdqlaalradmtlldgav
    eemlryegpvesatyrfpvepvdldgtvipagdtvlvvladahrtperfpdphrfdirrd
    taghlafghgihfcigaplarleariavrallercpdlaldvspgelvwypnpmirglka
    lpirwrrgreagrrtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2whwB (B:)
    vldlgalgqdfaadpyptyarlraegpahrvrtpegnevwlvvgydraravladprfskd
    wrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdglvda
    mlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqtamae
    msgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettvnlia
    ngmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvipagd
    tvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavralle
    rcpdlaldvspgelvwypnpmirglkalpirwr