PDB entry 2whl

View 2whl on RCSB PDB site
Description: Understanding how diverse mannanases recognise heterogeneous substrates
Class: hydrolase
Keywords: mannanase, glycoside hydrolase, hydrolase
Deposited on 2009-05-05, released 2009-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.152
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-mannanase
    Species: BACILLUS AGARADHAERENS [TaxId:76935]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5YEX6 (0-293)
      • engineered mutation (2)
      • conflict (19)
      • conflict (65)
      • conflict (96)
      • conflict (131)
      • conflict (184)
      • conflict (252-253)
      • conflict (266)
      • conflict (280)
    Domains in SCOPe 2.07: d2whla_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2whlA (A:)
gfsvdgntlydangqpfvmrginhghawykdtastaipaiaeqgantirivlsdggqwek
ddidtirevielaeqnkmvavvevhdatgrdsrsdlnravdywiemkdaligkedtviin
ianewygswdgsawadgyidvipklrdaglthtlmvdaagwgqypqsihdygqdvfnadp
lkntmfsihmyeyaggdantvrsnidrvidqdlalvigefghrhtdvdedtilsyseetg
tgwlawswkgnstswdyldlsedwagqhltdwgnrivhgadglqetskpstvft