PDB entry 2whl

View 2whl on RCSB PDB site
Description: Understanding how diverse mannanases recognise heterogeneous substrates
Class: hydrolase
Keywords: mannanase, glycoside hydrolase, hydrolase
Deposited on 2009-05-05, released 2009-05-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-mannanase
    Species: BACILLUS AGARADHAERENS [TaxId:76935]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5YEX6 (0-293)
      • engineered mutation (2)
      • conflict (19)
      • conflict (65)
      • conflict (96)
      • conflict (131)
      • conflict (184)
      • conflict (252-253)
      • conflict (266)
      • conflict (280)
    Domains in SCOPe 2.08: d2whla_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2whlA (A:)
    gfsvdgntlydangqpfvmrginhghawykdtastaipaiaeqgantirivlsdggqwek
    ddidtirevielaeqnkmvavvevhdatgrdsrsdlnravdywiemkdaligkedtviin
    ianewygswdgsawadgyidvipklrdaglthtlmvdaagwgqypqsihdygqdvfnadp
    lkntmfsihmyeyaggdantvrsnidrvidqdlalvigefghrhtdvdedtilsyseetg
    tgwlawswkgnstswdyldlsedwagqhltdwgnrivhgadglqetskpstvft