PDB entry 2whe

View 2whe on RCSB PDB site
Description: structure of native beta-phosphoglucomutase in an open conformation without bound ligands.
Class: isomerase
Keywords: isomerase, phosphotransferase, haloacid dehalogenase superfamily
Deposited on 2009-05-04, released 2009-09-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-03-23, with a file datestamp of 2010-03-19.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.177
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta-phosphoglucomutase
  Species: LACTOCOCCUS LACTIS [TaxId:1358]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P71447 (0-220)
    • conflict (205)
  Domains in SCOPe 2.08: d2whea_
• Heterogens: MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2wheA (A:)
  mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
  dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
  fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
  sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk