PDB entry 2wh9

View 2wh9 on RCSB PDB site
Description: solution structure of gxtx-1e
Deposited on 2009-05-02, released 2010-05-26
The last revision was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guangxitoxin-1egxtx-1e
    Species: PLESIOPHRICTUS GUANGXIENSIS, synthetic [TaxId:378181]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2wh9A (A:)
egecggfwwkcgsgkpaccpkyvcspkwglcnfpmp