PDB entry 2wh7

View 2wh7 on RCSB PDB site
Description: the partial structure of a group a streptpcoccal phage-encoded tail fibre hyaluronate lyase hylp2
Deposited on 2009-05-01, released 2009-09-01
The last revision was dated 2009-11-03, with a file datestamp of 2009-10-30.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.214
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hyaluronidase-phage associated
    Species: STREPTOCOCCUS PYOGENES [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WH7
    • Uniprot Q99ZZ7 (20-End)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2wh7A (A:)
mgsshhhhhhssglvprgshnavnivmrqpttpnfssalnitsaneggsamqirgvekal
gtlkithenpsvdkeydknaaalsidivkkqkggkgtaaqgiyinstsgttgkllrirnl
nddkfyvkpdggfyaketsqidgnlklkdpiandhaatkayvdgeveklkallaakqm

    Sequence, based on observed residues (ATOM records):
    >2wh7A (A:)
navnivmrqpttpnfssalnitsaneggsamqirgvekalgtlkithenpsvdkeydkna
aalsidivkkqkggkgtaaqgiyinstsgttgkllrirnlnddkfyvkpdggfyaketsq
idgnlklkdpiandhaatkayvdgeveklkal