PDB entry 2wgr

View 2wgr on RCSB PDB site
Description: Combining crystallography and molecular dynamics: The case of Schistosoma mansoni phospholipid glutathione peroxidase
Class: oxidoreductase
Keywords: selenium, oxidoreductase, selenocysteine, schistosomiasis, lipid gsh peroxidase, molecular dynamics simulations, ros detoxification pathway
Deposited on 2009-04-24, released 2009-09-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.18355
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione peroxidase
    Species: Schistosoma mansoni [TaxId:6183]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00277 (Start-168)
      • engineered mutation (42)
    Domains in SCOPe 2.08: d2wgra_
  • Heterogens: POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2wgrA (A:)
mssshkswnsiyeftvkdingvdvslekyrghvclivnvacksgatdknyrqlqemhtrl
vgkglrilafpcnqfggqepwaeaeikkfvtekygvqfdmfskikvngsdaddlykflks
rqhgtltnnikwnfskflvdrqgqpvkryspttapydiegdimellekk

    Sequence, based on observed residues (ATOM records): (download) 
    >2wgrA (A:)
swnsiyeftvkdingvdvslekyrghvclivnvacksgatdknyrqlqemhtrlvgkglr
ilafpcnqfggqepwaeaeikkfvtekygvqfdmfskikvngsdaddlykflksrqhgtl
tnnikwnfskflvdrqgqpvkryspttapydiegdimellekk