PDB entry 2wgq

View 2wgq on RCSB PDB site
Description: zinc substituted e coli copper amine oxidase, a model for the precursor for 2,4,5-trihydroxyphenylalaninequinone formation
Class: oxidoreductase
Keywords: tpq, zinc, copper, calcium, periplasm, amine oxidase, metal-binding, oxidoreductase
Deposited on 2009-04-23, released 2009-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2071
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wgqA (A:)
    hggeahmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvp
    vvmkdnkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpn
    trfteisllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpi
    kdahgmvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqda
    rllkvisyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva
    pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
    slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
    meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
    gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
    nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
    vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
    dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
    galkkdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgqA (A:)
    ahmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmk
    dnkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpntrft
    eisllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpikdah
    gmvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllk
    visyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrvapavk
    pmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyegslgg
    mivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvpmeip
    raiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengtigida
    gatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgennslv
    amdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnpvsyq
    iipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsthdtgl
    gqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptlgalk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wgqB (B:)
    hggeahmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvp
    vvmkdnkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpn
    trfteisllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpi
    kdahgmvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqda
    rllkvisyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva
    pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
    slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
    meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
    gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
    nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
    vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
    dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
    galkkdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgqB (B:)
    ahmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmk
    dnkawvsdtfindvfqsgldqtfqvekrphplnaltadeikqaveivkasadfkpntrft
    eisllppdkeavwafalenkpvdqprkadvimldgkhiieavvdlqnnkllswqpikdah
    gmvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllk
    visyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrvapavk
    pmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyegslgg
    mivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvpmeip
    raiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengtigida
    gatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgennslv
    amdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnpvsyq
    iipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsthdtgl
    gqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptlgalk
    kdk