PDB entry 2wgo

View 2wgo on RCSB PDB site
Description: structure of ranaspumin-2, a surfactant protein from the foam nests of a tropical frog
Deposited on 2009-04-21, released 2009-06-23
The last revision was dated 2009-06-23, with a file datestamp of 2009-06-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ranaspumin-2
    Species: ENGYSTOMOPS PUSTULOSUS [TaxId:76066]
    Database cross-references and differences (RAF-indexed):
    • PDB 2WGO (0-1)
      • conflict (34)
    • Uniprot B5DCK2 (2-97)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2wgoA (A:)
    gslildgdllkdklklpvidnlfgkelldkfqddikdkygvdtkdlkilktsedkrfyyv
    svdagdgekckfkirkdvdvpkmvgrkcrkddddddgy