PDB entry 2wgn

View 2wgn on RCSB PDB site
Description: pseudomonas aeruginosa icp
Deposited on 2009-04-21, released 2010-07-07
The last revision was dated 2010-07-07, with a file datestamp of 2010-07-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: inhibitor of cysteine peptidase compnd 3
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I5G0 (21-131)
      • expression tag (0-20)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2wgnB (B:)
    mgsshhhhhhssglvprgshmqkpvvtlddaddcsplkltqgqelvltlpsnpttgfrwe
    lrnpaasvlkrlgpevysnseedsglvgsggestwrfrvaasgddrlelvyrrpwekdae
    paesfscaiqvr