PDB entry 2wgj

View 2wgj on RCSB PDB site
Description: x-ray structure of pf-02341066 bound to the kinase domain of c-met
Class: transferase
Keywords: c-met, kinase, inhibitor, transferase, ATP-binding, nucleotide-binding, tyrosine-protein kinase
Deposited on 2009-04-20, released 2009-06-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21485
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2WGJ
      • conflict (222)
    • Uniprot P08581
    Domains in SCOPe 2.06: d2wgja_
  • Heterogens: VGH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wgjA (A:)
    mvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcav
    kslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfi
    rnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardm
    ydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvnt
    fditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehh
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgjA (A:)
    hidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtllkkihcavkslnri
    tdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethn
    ptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyy
    svhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvy
    llqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfi