SCOPe 2.05: Structural Classification of Proteins

PDB entry 2wgg

View 2wgg on RCSB PDB site
Description: Crystal Structure of Mycobacterium tuberculosis C171Q KasA variant with bound TLM
Class: transferase
Keywords: beta ketoacyl synthase I, transferase, acyltransferase, lipid synthesis, fatty acid biosynthesis
Deposited on 2009-04-17, released 2009-07-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.139
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 1
Species: Mycobacterium tuberculosis [TaxId:1773]
Database cross-references and differences (RAF-indexed):
- Uniprot P63454 (Start-415)
  - engineered mutation (170)
Domains in SCOPe 2.05: d2wgga1, d2wgga2
Chain 'B':
Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 1
Species: Mycobacterium tuberculosis [TaxId:1773]
Database cross-references and differences (RAF-indexed):
- Uniprot P63454 (Start-415)
  - engineered mutation (170)
Domains in SCOPe 2.05: d2wggb1, d2wggb2
Chain 'C':
Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 1
Species: Mycobacterium tuberculosis [TaxId:1773]
Database cross-references and differences (RAF-indexed):
- Uniprot P63454 (Start-415)
  - engineered mutation (170)
Domains in SCOPe 2.05: d2wggc1, d2wggc2
Chain 'D':
Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 1
Species: Mycobacterium tuberculosis [TaxId:1773]
Database cross-references and differences (RAF-indexed):
- Uniprot P63454 (Start-415)
  - engineered mutation (170)
Domains in SCOPe 2.05: d2wggd1, d2wggd2
Chain 'E':
Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 1
Species: Mycobacterium tuberculosis [TaxId:1773]
Database cross-references and differences (RAF-indexed):
- Uniprot P63454 (Start-415)
  - engineered mutation (170)
Domains in SCOPe 2.05: d2wgge1, d2wgge2
Chain 'F':
Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 1
Species: Mycobacterium tuberculosis [TaxId:1773]
Database cross-references and differences (RAF-indexed):
- Uniprot P63454 (Start-415)
  - engineered mutation (170)
Domains in SCOPe 2.05: d2wggf1, d2wggf2
Chain 'G':
Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 1
Species: Mycobacterium tuberculosis [TaxId:1773]
Database cross-references and differences (RAF-indexed):
- Uniprot P63454 (Start-415)
  - engineered mutation (170)
Domains in SCOPe 2.05: d2wggg1, d2wggg2
Chain 'H':
Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 1
Species: Mycobacterium tuberculosis [TaxId:1773]
Database cross-references and differences (RAF-indexed):
- Uniprot P63454 (Start-415)
  - engineered mutation (170)
Domains in SCOPe 2.05: d2wggh1, d2wggh2
Heterogens: TLM, NA, 2PE, PEG, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>2wggA (A:)
msqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavki
gghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggae
rivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsaqssgseaiah
awrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfg
eagalmlieteehakargakplarllgagitsdafhmvapaadgvragramtrslelagl
spadidhvnahgtatpigdaaeanairvagcdqaavyapksalghsigavgalesvltvl
tlrdgvipptlnyetpdpeidldvvageprygdyryavnnsfgfgghnvalafgry