PDB entry 2wgf

View 2wgf on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis C171Q KasA variant
Class: transferase
Keywords: beta ketoacyl synthase I, transferase, acyltransferase, lipid synthesis, fatty acid biosynthesis
Deposited on 2009-04-17, released 2009-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.168
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 1
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63454 (Start-415)
      • engineered mutation (170)
    Domains in SCOPe 2.07: d2wgfa1, d2wgfa2
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 1
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63454 (Start-415)
      • engineered mutation (170)
    Domains in SCOPe 2.07: d2wgfb1, d2wgfb2
  • Chain 'C':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 1
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63454 (Start-415)
      • engineered mutation (170)
    Domains in SCOPe 2.07: d2wgfc1, d2wgfc2
  • Chain 'D':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 1
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63454 (Start-415)
      • engineered mutation (170)
    Domains in SCOPe 2.07: d2wgfd1, d2wgfd2
  • Chain 'E':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 1
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63454 (Start-415)
      • engineered mutation (170)
    Domains in SCOPe 2.07: d2wgfe1, d2wgfe2
  • Chain 'F':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 1
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63454 (Start-415)
      • engineered mutation (170)
    Domains in SCOPe 2.07: d2wgff1, d2wgff2
  • Chain 'G':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 1
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63454 (Start-415)
      • engineered mutation (170)
    Domains in SCOPe 2.07: d2wgfg1, d2wgfg2
  • Chain 'H':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 1
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63454 (Start-415)
      • engineered mutation (170)
    Domains in SCOPe 2.07: d2wgfh1, d2wgfh2
  • Heterogens: NA, PG4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wgfA (A:)
    msqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavki
    gghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggae
    rivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsaqssgseaiah
    awrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfg
    eagalmlieteehakargakplarllgagitsdafhmvapaadgvragramtrslelagl
    spadidhvnahgtatpigdaaeanairvagcdqaavyapksalghsigavgalesvltvl
    tlrdgvipptlnyetpdpeidldvvageprygdyryavnnsfgfgghnvalafgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgfA (A:)
    sqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavkig
    ghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggaer
    ivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsaqssgseaiaha
    wrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfge
    agalmlieteehakargakplarllgagitsdafhmvapaadgvragramtrslelagls
    padidhvnahgtatpigdaaeanairvagcdqaavyapksalghsigavgalesvltvlt
    lrdgvipptlnyetpdpeidldvvageprygdyryavnnsfgfgghnvalafgry
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2wgfB (B:)
    msqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavki
    gghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggae
    rivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsaqssgseaiah
    awrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfg
    eagalmlieteehakargakplarllgagitsdafhmvapaadgvragramtrslelagl
    spadidhvnahgtatpigdaaeanairvagcdqaavyapksalghsigavgalesvltvl
    tlrdgvipptlnyetpdpeidldvvageprygdyryavnnsfgfgghnvalafgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgfB (B:)
    sqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavkig
    ghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggaer
    ivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsaqssgseaiaha
    wrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfge
    agalmlieteehakargakplarllgagitsdafhmvapaadgvragramtrslelagls
    padidhvnahgtatpigdaaeanairvagcdqaavyapksalghsigavgalesvltvlt
    lrdgvipptlnyetpdpeidldvvageprygdyryavnnsfgfgghnvalafgry
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2wgfC (C:)
    msqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavki
    gghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggae
    rivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsaqssgseaiah
    awrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfg
    eagalmlieteehakargakplarllgagitsdafhmvapaadgvragramtrslelagl
    spadidhvnahgtatpigdaaeanairvagcdqaavyapksalghsigavgalesvltvl
    tlrdgvipptlnyetpdpeidldvvageprygdyryavnnsfgfgghnvalafgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgfC (C:)
    sqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavkig
    ghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggaer
    ivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsaqssgseaiaha
    wrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfge
    agalmlieteehakargakplarllgagitsdafhmvapaadgvragramtrslelagls
    padidhvnahgtatpigdaaeanairvagcdqaavyapksalghsigavgalesvltvlt
    lrdgvipptlnyetpdpeidldvvageprygdyryavnnsfgfgghnvalafgry
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2wgfD (D:)
    msqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavki
    gghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggae
    rivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsaqssgseaiah
    awrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfg
    eagalmlieteehakargakplarllgagitsdafhmvapaadgvragramtrslelagl
    spadidhvnahgtatpigdaaeanairvagcdqaavyapksalghsigavgalesvltvl
    tlrdgvipptlnyetpdpeidldvvageprygdyryavnnsfgfgghnvalafgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgfD (D:)
    sqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavkig
    ghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggaer
    ivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsaqssgseaiaha
    wrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfge
    agalmlieteehakargakplarllgagitsdafhmvapaadgvragramtrslelagls
    padidhvnahgtatpigdaaeanairvagcdqaavyapksalghsigavgalesvltvlt
    lrdgvipptlnyetpdpeidldvvageprygdyryavnnsfgfgghnvalafgry
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2wgfE (E:)
    msqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavki
    gghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggae
    rivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsaqssgseaiah
    awrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfg
    eagalmlieteehakargakplarllgagitsdafhmvapaadgvragramtrslelagl
    spadidhvnahgtatpigdaaeanairvagcdqaavyapksalghsigavgalesvltvl
    tlrdgvipptlnyetpdpeidldvvageprygdyryavnnsfgfgghnvalafgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgfE (E:)
    sqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavkig
    ghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggaer
    ivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsaqssgseaiaha
    wrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfge
    agalmlieteehakargakplarllgagitsdafhmvapaadgvragramtrslelagls
    padidhvnahgtatpigdaaeanairvagcdqaavyapksalghsigavgalesvltvlt
    lrdgvipptlnyetpdpeidldvvageprygdyryavnnsfgfgghnvalafgry
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2wgfF (F:)
    msqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavki
    gghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggae
    rivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsaqssgseaiah
    awrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfg
    eagalmlieteehakargakplarllgagitsdafhmvapaadgvragramtrslelagl
    spadidhvnahgtatpigdaaeanairvagcdqaavyapksalghsigavgalesvltvl
    tlrdgvipptlnyetpdpeidldvvageprygdyryavnnsfgfgghnvalafgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgfF (F:)
    sqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavkig
    ghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggaer
    ivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsaqssgseaiaha
    wrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfge
    agalmlieteehakargakplarllgagitsdafhmvapaadgvragramtrslelagls
    padidhvnahgtatpigdaaeanairvagcdqaavyapksalghsigavgalesvltvlt
    lrdgvipptlnyetpdpeidldvvageprygdyryavnnsfgfgghnvalafgry
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2wgfG (G:)
    msqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavki
    gghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggae
    rivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsaqssgseaiah
    awrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfg
    eagalmlieteehakargakplarllgagitsdafhmvapaadgvragramtrslelagl
    spadidhvnahgtatpigdaaeanairvagcdqaavyapksalghsigavgalesvltvl
    tlrdgvipptlnyetpdpeidldvvageprygdyryavnnsfgfgghnvalafgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgfG (G:)
    sqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavkig
    ghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggaer
    ivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsaqssgseaiaha
    wrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfge
    agalmlieteehakargakplarllgagitsdafhmvapaadgvragramtrslelagls
    padidhvnahgtatpigdaaeanairvagcdqaavyapksalghsigavgalesvltvlt
    lrdgvipptlnyetpdpeidldvvageprygdyryavnnsfgfgghnvalafgry
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2wgfH (H:)
    msqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavki
    gghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggae
    rivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsaqssgseaiah
    awrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfg
    eagalmlieteehakargakplarllgagitsdafhmvapaadgvragramtrslelagl
    spadidhvnahgtatpigdaaeanairvagcdqaavyapksalghsigavgalesvltvl
    tlrdgvipptlnyetpdpeidldvvageprygdyryavnnsfgfgghnvalafgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgfH (H:)
    sqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavkig
    ghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggaer
    ivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsaqssgseaiaha
    wrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfge
    agalmlieteehakargakplarllgagitsdafhmvapaadgvragramtrslelagls
    padidhvnahgtatpigdaaeanairvagcdqaavyapksalghsigavgalesvltvlt
    lrdgvipptlnyetpdpeidldvvageprygdyryavnnsfgfgghnvalafgry