PDB entry 2wgd

View 2wgd on RCSB PDB site
Description: Crystal structure of KasA of Mycobacterium tuberculosis
Class: transferase
Keywords: beta ketoacyl synthase I, transferase, acyltransferase, lipid synthesis, fatty acid biosynthesis
Deposited on 2009-04-17, released 2009-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.181
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 1
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2wgda1, d2wgda2
  • Heterogens: GOL, IPA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2wgdA (A:)
    msqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavki
    gghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggae
    rivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsacssgseaiah
    awrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfg
    eagalmlieteehakargakplarllgagitsdafhmvapaadgvragramtrslelagl
    spadidhvnahgtatpigdaaeanairvagcdqaavyapksalghsigavgalesvltvl
    tlrdgvipptlnyetpdpeidldvvageprygdyryavnnsfgfgghnvalafgry
    

    Sequence, based on observed residues (ATOM records): (download)
    >2wgdA (A:)
    sqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavkig
    ghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggaer
    ivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsacssgseaiaha
    wrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfge
    agalmlieteehakargakplarllgagitsdafhmvapaadgvragramtrslelagls
    padidhvnahgtatpigdaaeanairvagcdqaavyapksalghsigavgalesvltvlt
    lrdgvipptlnyetpdpeidldvvageprygdyryavnnsfgfgghnvalafgry