SCOPe 2.08: Structural Classification of Proteins

PDB entry 2wg5

View 2wg5 on RCSB PDB site
Description: proteasome-activating nucleotidase (pan) n-domain (57-134) from archaeoglobus fulgidus fused to gcn4
Deposited on 2009-04-15, released 2009-04-28
The last revision was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: general control protein gcn4, proteasome-activating nucleotidase
Species: Archaeoglobus fulgidus [TaxId:2234]
Database cross-references and differences (RAF-indexed):
- Uniprot P03069 (Start-30)
- Uniprot O28303 (31-End)
Chain 'B':
Compound: general control protein gcn4, proteasome-activating nucleotidase
Species: Archaeoglobus fulgidus [TaxId:2234]
Database cross-references and differences (RAF-indexed):
- Uniprot P03069 (Start-30)
- Uniprot O28303 (31-End)
Chain 'C':
Compound: general control protein gcn4, proteasome-activating nucleotidase
Species: Archaeoglobus fulgidus [TaxId:2234]
Database cross-references and differences (RAF-indexed):
- Uniprot P03069 (Start-30)
- Uniprot O28303 (31-End)
Chain 'D':
Compound: general control protein gcn4, proteasome-activating nucleotidase
Species: Archaeoglobus fulgidus [TaxId:2234]
Database cross-references and differences (RAF-indexed):
- Uniprot P03069 (Start-30)
- Uniprot O28303 (31-End)
Chain 'E':
Compound: general control protein gcn4, proteasome-activating nucleotidase
Species: Archaeoglobus fulgidus [TaxId:2234]
Database cross-references and differences (RAF-indexed):
- Uniprot P03069 (Start-30)
- Uniprot O28303 (31-End)
Chain 'F':
Compound: general control protein gcn4, proteasome-activating nucleotidase
Species: Archaeoglobus fulgidus [TaxId:2234]
Database cross-references and differences (RAF-indexed):
- Uniprot P03069 (Start-30)
- Uniprot O28303 (31-End)
Chain 'G':
Compound: general control protein gcn4, proteasome-activating nucleotidase
Species: Archaeoglobus fulgidus [TaxId:2234]
Database cross-references and differences (RAF-indexed):
- Uniprot P03069 (Start-30)
- Uniprot O28303 (31-End)
Chain 'H':
Compound: general control protein gcn4, proteasome-activating nucleotidase
Species: Archaeoglobus fulgidus [TaxId:2234]
Database cross-references and differences (RAF-indexed):
- Uniprot P03069 (Start-30)
- Uniprot O28303 (31-End)
Chain 'I':
Compound: general control protein gcn4, proteasome-activating nucleotidase
Species: Archaeoglobus fulgidus [TaxId:2234]
Database cross-references and differences (RAF-indexed):
- Uniprot P03069 (Start-30)
- Uniprot O28303 (31-End)
Chain 'J':
Compound: general control protein gcn4, proteasome-activating nucleotidase
Species: Archaeoglobus fulgidus [TaxId:2234]
Database cross-references and differences (RAF-indexed):
- Uniprot P03069 (Start-30)
- Uniprot O28303 (31-End)
Chain 'K':
Compound: general control protein gcn4, proteasome-activating nucleotidase
Species: Archaeoglobus fulgidus [TaxId:2234]
Database cross-references and differences (RAF-indexed):
- Uniprot P03069 (Start-30)
- Uniprot O28303 (31-End)
Chain 'L':
Compound: general control protein gcn4, proteasome-activating nucleotidase
Species: Archaeoglobus fulgidus [TaxId:2234]
Database cross-references and differences (RAF-indexed):
- Uniprot P03069 (Start-30)
- Uniprot O28303 (31-End)
Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

Chain 'A':
Sequence, based on SEQRES records:

>2wg5A (A:)
mhhhhhhrmkqledkveellsknyhlenevarlrsppllvgvvsdiledgrvvvksstgp
kfvvntsqyineeelkpgarvalnqqtlaivnvlptskdpmvygfevee